StarFunc result for job id P52803

User Input

>input (228 residues)
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08543	0.800	0.800	7.229E-44	228	0.991	0.991	O08543.pdb.gz	EFNA5_MOUSE Ephrin-A5 OS=Mus musculus OX=10090 GN=Efna5 PE=1 SV=1
2	AFDB:P79728	0.735	0.735	1.982E-32	228	0.754	0.754	P79728.pdb.gz	EFNA5_DANRE Ephrin-A5b OS=Danio rerio OX=7955 GN=efna5b PE=1 SV=1
3	AFDB:A0A0B5JK29	0.600	0.781	6.084E-24	173	0.430	0.566	A0A0B5JK29.pdb.gz
4	AFDB:O43921	0.562	0.600	2.383E-22	213	0.412	0.441	O43921.pdb.gz	EFNA2_HUMAN Ephrin-A2 OS=Homo sapiens OX=9606 GN=EFNA2 PE=1 SV=1
5	AFDB:P20827	0.633	0.699	1.261E-20	205	0.386	0.429	P20827.pdb.gz	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2
6	AFDB:P52793	0.608	0.673	1.809E-20	205	0.390	0.434	P52793.pdb.gz	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
7	AFDB:P52797	0.571	0.549	1.921E-20	238	0.382	0.366	P52797.pdb.gz	EFNA3_HUMAN Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3 PE=1 SV=1
8	AFDB:A0A0B5JFB8	0.587	0.682	2.166E-20	194	0.346	0.407	A0A0B5JFB8.pdb.gz
9	AFDB:Q98TZ1	0.576	0.644	9.739E-20	202	0.355	0.401	Q98TZ1.pdb.gz	Q98TZ1_CHICK Ephrin-A6 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
10	AFDB:P52798	0.564	0.634	8.853E-18	201	0.360	0.408	P52798.pdb.gz	EFNA4_HUMAN Ephrin-A4 OS=Homo sapiens OX=9606 GN=EFNA4 PE=1 SV=1
11	PDB:4n2iA	0.210	0.090	1.483E-2	662	0.075	0.026	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
12	PDB:4v96AA	0.247	0.203	1.886E-2	299	0.083	0.064	4v96AA.pdb.gz
13	PDB:3fszA	0.288	0.444	2.547E-2	129	0.070	0.124	3fszA.pdb.gz	Metal-binding loop length and not sequence dictates structure.
14	PDB:2dv6A	0.235	0.143	2.705E-2	422	0.070	0.038	2dv6A.pdb.gz	Structure and function of a hexameric copper-containing nitrite reductase.
15	PDB:7q5zA	0.213	0.049	2.873E-2	1344	0.061	0.010	7q5zA.pdb.gz
16	PDB:2aanA	0.298	0.472	3.051E-2	123	0.066	0.122	2aanA.pdb.gz	The Crystal Structure of Auracyanin A at 1.85 A Resolution: Why the Photosynthetic Bacterium Chloroflexus Needs Two Almost Identical 'Blue' Copper Proteins
17	PDB:6cjzA	0.278	0.538	3.051E-2	105	0.057	0.124	6cjzA.pdb.gz
18	PDB:2bo0A	0.226	0.163	4.647E-2	336	0.061	0.042	2bo0A.pdb.gz	High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
19	PDB:4bxsV	0.239	0.058	4.647E-2	1262	0.088	0.016	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
20	PDB:3divA	0.251	0.136	9.005E-2	499	0.075	0.034	3divA.pdb.gz	Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52803	1.42e-173	478	228	1.000	1.000	EFNA5_HUMAN Ephrin-A5 OS=Homo sapiens OX=9606 GN=EFNA5 PE=1 SV=1
2	O08543	2.07e-172	474	228	0.991	0.991	EFNA5_MOUSE Ephrin-A5 OS=Mus musculus OX=10090 GN=Efna5 PE=1 SV=1
3	P97605	2.98e-171	471	228	0.987	0.987	EFNA5_RAT Ephrin-A5 OS=Rattus norvegicus OX=10116 GN=Efna5 PE=1 SV=2
4	P79728	4.62e-125	355	228	0.719	0.719	EFNA5_DANRE Ephrin-A5b OS=Danio rerio OX=7955 GN=efna5b PE=1 SV=1
5	F1MA19	1.88e-66	206	209	0.421	0.459	F1MA19_RAT Ephrin A2 OS=Rattus norvegicus OX=10116 GN=Efna2 PE=3 SV=1
6	P52801	1.88e-66	206	209	0.421	0.459	EFNA2_MOUSE Ephrin-A2 OS=Mus musculus OX=10090 GN=Efna2 PE=1 SV=1
7	O43921	4.93e-63	197	213	0.404	0.432	EFNA2_HUMAN Ephrin-A2 OS=Homo sapiens OX=9606 GN=EFNA2 PE=1 SV=1
8	A0A8I5ZVQ1	4.45e-49	161	204	0.329	0.368	A0A8I5ZVQ1_RAT Ephrin A3 OS=Rattus norvegicus OX=10116 GN=Efna3 PE=3 SV=1
9	A0A0G2JV56	9.57e-49	161	230	0.329	0.326	A0A0G2JV56_RAT Ephrin A3 OS=Rattus norvegicus OX=10116 GN=Efna3 PE=3 SV=2
10	O08545	9.57e-49	161	230	0.329	0.326	EFNA3_MOUSE Ephrin-A3 OS=Mus musculus OX=10090 GN=Efna3 PE=1 SV=4
11	P52797	1.56e-46	155	238	0.333	0.319	EFNA3_HUMAN Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3 PE=1 SV=1
12	Q98TZ1	4.51e-46	153	202	0.320	0.361	Q98TZ1_CHICK Ephrin-A6 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
13	P20827	9.25e-45	150	205	0.320	0.356	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2
14	P52793	1.04e-44	150	205	0.333	0.371	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
15	P97553	1.14e-44	150	205	0.325	0.361	EFNA1_RAT Ephrin-A1 OS=Rattus norvegicus OX=10116 GN=Efna1 PE=2 SV=2
16	P52798	8.92e-38	132	201	0.316	0.358	EFNA4_HUMAN Ephrin-A4 OS=Homo sapiens OX=9606 GN=EFNA4 PE=1 SV=1
17	G5EEE7	9.39e-13	67.8	279	0.171	0.140	G5EEE7_CAEEL Ephrin RBD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-2 PE=2 SV=1
18	A5HTT2	7.50e-12	65.9	340	0.246	0.165	A5HTT2_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=2 SV=1
19	O35393	7.50e-12	65.9	340	0.246	0.165	EFNB3_MOUSE Ephrin-B3 OS=Mus musculus OX=10090 GN=Efnb3 PE=1 SV=1
20	O73612	1.08e-11	65.5	334	0.197	0.135	EFNB1_CHICK Ephrin-B1 OS=Gallus gallus OX=9031 GN=EFNB1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00812 Ephrin	1.6e-42	156.3	Ephrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010606898.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010601196.1	0.999	Ephrin type-A receptor 3
2	885580.XP_010612568.1	0.999	Ephrin type-A receptor 2
3	885580.XP_010610107.1	0.998	Ephrin type-A receptor 4
4	885580.XP_010624297.1	0.996	Ephrin type-B receptor 2 isoform X1
5	885580.XP_010632217.1	0.985	Ephrin type-A receptor 7 isoform X1
6	885580.XP_010624996.1	0.980	Receptor protein-tyrosine kinase
7	885580.XP_010605961.1	0.971	Ephrin type-A receptor 1 isoform X1
8	885580.XP_010624390.1	0.966	Ephrin type-A receptor 8
9	885580.XP_010642894.1	0.966	Ephrin type-A receptor 6
10	885580.XP_010603820.1	0.963	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
11	885580.XP_010608126.1	0.944	Ephrin type-B receptor 4
12	885580.XP_010623805.1	0.938	Receptor protein-tyrosine kinase
13	885580.XP_010642083.1	0.918	High affinity nerve growth factor receptor
14	885580.XP_010620181.1	0.899	Hepatocyte growth factor receptor
15	885580.XP_010622542.1	0.899	Ephrin type-B receptor 3
16	885580.XP_010618623.1	0.895	Tumor necrosis factor receptor superfamily member 16
17	885580.XP_010629141.1	0.890	Tyrosine-protein kinase
18	885580.XP_010606177.1	0.879	Insulin-like growth factor 1 receptor
19	885580.XP_010603206.1	0.875	Basic fibroblast growth factor receptor 1
20	885580.XP_010620397.1	0.875	Fibroblast growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046875	0.999	ephrin receptor binding
GO:0098772	0.461	molecular function regulator activity
GO:0140677	0.301	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0051716	0.981	cellular response to stimulus
GO:0007154	0.977	cell communication
GO:0032502	0.970	developmental process
GO:0048856	0.953	anatomical structure development
GO:0032501	0.949	multicellular organismal process
GO:0023052	0.935	signaling
GO:0007169	0.933	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048731	0.877	system development
GO:0048518	0.859	positive regulation of biological process
GO:0048522	0.849	positive regulation of cellular process
GO:0060322	0.777	head development
GO:0051128	0.768	regulation of cellular component organization
GO:0048519	0.765	negative regulation of biological process
GO:0007399	0.757	nervous system development
GO:0023051	0.747	regulation of signaling
GO:0010646	0.739	regulation of cell communication
GO:0050793	0.724	regulation of developmental process
GO:0019222	0.718	regulation of metabolic process
GO:0007417	0.685	central nervous system development
GO:0065009	0.594	regulation of molecular function
GO:0048013	0.563	ephrin receptor signaling pathway
GO:0048523	0.544	negative regulation of cellular process
GO:0031323	0.485	regulation of cellular metabolic process
GO:0060255	0.483	regulation of macromolecule metabolic process
GO:0080090	0.481	regulation of primary metabolic process
GO:0042221	0.469	response to chemical
GO:0030155	0.462	regulation of cell adhesion
GO:0050790	0.458	regulation of catalytic activity
GO:0051171	0.449	regulation of nitrogen compound metabolic process
GO:0065008	0.446	regulation of biological quality
GO:0051246	0.428	regulation of protein metabolic process
GO:0044087	0.408	regulation of cellular component biogenesis
GO:0051336	0.401	regulation of hydrolase activity
GO:0071840	0.393	cellular component organization or biogenesis
GO:0010604	0.386	positive regulation of macromolecule metabolic process
GO:0019220	0.377	regulation of phosphate metabolic process
GO:0051173	0.353	positive regulation of nitrogen compound metabolic process
GO:0031325	0.350	positive regulation of cellular metabolic process
GO:0016043	0.345	cellular component organization
GO:0048583	0.341	regulation of response to stimulus
GO:0001932	0.338	regulation of protein phosphorylation
GO:0070887	0.331	cellular response to chemical stimulus
GO:0009605	0.321	response to external stimulus
GO:0051247	0.307	positive regulation of protein metabolic process
GO:0048513	0.304	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.628	cell junction
GO:0005622	0.488	intracellular anatomical structure
GO:0043226	0.453	organelle
GO:0043231	0.424	intracellular membrane-bounded organelle
GO:0045202	0.409	synapse
GO:0005737	0.398	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]