StarFunc result for job id P52824

User Input

>input (942 residues)
MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPG
HSFRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPV
AHCFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHD
THHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLR
SLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTL
KIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAW
AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPK
STARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVR
QVSQTRFYVAESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQG
AVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGL
KGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEET
RYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSVLLSVDEADAVLMDRWTILLD
AHEAGSAENDTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYV
RVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKP
RMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGH
MIISAAGPKVHMLRKAKQKPRRAGTTRDARADAAPAPESDPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZEY4	0.935	0.940	0.000	937	0.809	0.813	D3ZEY4.pdb.gz	DGKQ_RAT Diacylglycerol kinase theta OS=Rattus norvegicus OX=10116 GN=Dgkq PE=1 SV=1
2	AFDB:P52824	1.000	1.000	0.000	942	1.000	1.000	P52824.pdb.gz	DGKQ_HUMAN Diacylglycerol kinase theta OS=Homo sapiens OX=9606 GN=DGKQ PE=1 SV=2
3	AFDB:Q17860	0.830	0.822	2.052E-101	952	0.366	0.362	Q17860.pdb.gz	Q17860_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=2
4	AFDB:Q58AU4	0.793	0.812	7.940E-94	919	0.360	0.369	Q58AU4.pdb.gz	Q58AU4_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
5	AFDB:Q58AU5	0.664	0.780	4.491E-82	796	0.326	0.386	Q58AU5.pdb.gz	Q58AU5_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
6	AFDB:P34125	0.458	0.485	1.594E-45	887	0.208	0.221	P34125.pdb.gz	DGKA_DICDI Diacylglycerol kinase A OS=Dictyostelium discoideum OX=44689 GN=dgkA PE=1 SV=3
7	AFDB:Q9FFN7	0.461	0.602	1.368E-44	712	0.240	0.317	Q9FFN7.pdb.gz	DGK2_ARATH Diacylglycerol kinase 2 OS=Arabidopsis thaliana OX=3702 GN=DGK2 PE=1 SV=1
8	AFDB:Q9Y6T7	0.416	0.485	1.368E-44	804	0.215	0.252	Q9Y6T7.pdb.gz	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
9	AFDB:Q03603	0.414	0.487	2.374E-44	795	0.207	0.245	Q03603.pdb.gz	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
10	AFDB:A1L4Q0	0.417	0.679	5.262E-42	567	0.202	0.335	A1L4Q0.pdb.gz	A1L4Q0_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKE PE=2 SV=1
11	PDB:4l02A	0.240	0.559	3.731E-11	360	0.061	0.158	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
12	PDB:2bonB	0.218	0.658	1.401E-10	265	0.053	0.189	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
13	PDB:2bonA	0.212	0.596	4.709E-10	287	0.063	0.206	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
14	PDB:7cgpB	0.232	0.549	5.871E-10	345	0.055	0.151	7cgpB.pdb.gz
15	PDB:2qv7A	0.220	0.610	9.124E-10	303	0.056	0.175	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
16	PDB:2i2aA	0.192	0.572	5.693E-8	264	0.039	0.140	2i2aA.pdb.gz	NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
17	PDB:1u0tB	0.177	0.492	1.535E-7	276	0.044	0.149	1u0tB.pdb.gz
18	PDB:1u0rD	0.189	0.501	1.914E-7	301	0.047	0.146	1u0rD.pdb.gz
19	PDB:3afoA	0.196	0.452	3.143E-7	360	0.037	0.097	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
20	PDB:2an1B	0.163	0.471	4.885E-7	281	0.033	0.110	2an1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZEY4	0.0	1533	937	0.809	0.813	DGKQ_RAT Diacylglycerol kinase theta OS=Rattus norvegicus OX=10116 GN=Dgkq PE=1 SV=1
2	P52824	0.0	1903	942	1.000	1.000	DGKQ_HUMAN Diacylglycerol kinase theta OS=Homo sapiens OX=9606 GN=DGKQ PE=1 SV=2
3	Q17860	0.0	610	952	0.374	0.370	Q17860_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=2
4	Q58AU4	0.0	590	919	0.369	0.379	Q58AU4_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
5	Q6P5E8	0.0	1524	934	0.811	0.818	DGKQ_MOUSE Diacylglycerol kinase theta OS=Mus musculus OX=10090 GN=Dgkq PE=1 SV=1
6	Q7JNZ1	0.0	611	950	0.370	0.367	Q7JNZ1_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
7	Q58AU5	5.57e-119	384	796	0.235	0.278	Q58AU5_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
8	Q58AU6	6.52e-118	380	794	0.234	0.277	Q58AU6_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
9	A1L4Q0	6.65e-75	258	567	0.155	0.257	A1L4Q0_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKE PE=2 SV=1
10	P52429	6.65e-75	258	567	0.155	0.257	DGKE_HUMAN Diacylglycerol kinase epsilon OS=Homo sapiens OX=9606 GN=DGKE PE=1 SV=1
11	Q9R1C6	1.15e-74	258	564	0.152	0.254	DGKE_MOUSE Diacylglycerol kinase epsilon OS=Mus musculus OX=10090 GN=Dgke PE=1 SV=1
12	Q6NS52	4.86e-74	262	802	0.149	0.175	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
13	Q91WG7	1.20e-73	260	788	0.159	0.190	DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus OX=10090 GN=Dgkg PE=1 SV=1
14	P49621	1.45e-73	260	801	0.148	0.174	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
15	Q03603	2.00e-73	260	795	0.146	0.174	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
16	P49620	2.34e-73	259	788	0.160	0.192	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
17	Q9Y6T7	1.86e-72	257	804	0.151	0.177	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
18	P49619	9.54e-72	255	791	0.152	0.181	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
19	Q9FFN7	7.99e-70	248	712	0.168	0.222	DGK2_ARATH Diacylglycerol kinase 2 OS=Arabidopsis thaliana OX=3702 GN=DGK2 PE=1 SV=1
20	P51556	3.66e-68	244	727	0.151	0.195	DGKA_RAT Diacylglycerol kinase alpha OS=Rattus norvegicus OX=10116 GN=Dgka PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	7.4e-20	81.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	26	16.6	C1 domain
3	PF00609 DAGK_acc	2.6e-45	166.1	Diacylglycerol kinase accessory domain
4	PF00781 DAGK_cat	2.4e-20	83.8	Diacylglycerol kinase catalytic domain
5	PF00788 RA	2.7e-20	84.1	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273814

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479153	0.834	EH domain-containing protein 1
2	9606.ENSP00000220325	0.827	EH domain-containing protein 4
3	9606.ENSP00000263088	0.821	Phospholipase D2
4	9606.ENSP00000342793	0.807	Phospholipase D1
5	9606.ENSP00000338185	0.801	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
6	9606.ENSP00000260402	0.795	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
7	9606.ENSP00000367762	0.785	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
8	9606.ENSP00000443631	0.780	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
9	9606.ENSP00000360761	0.769	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
10	9606.ENSP00000314499	0.765	Cyclin-G-associated kinase
11	9606.ENSP00000388631	0.748	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
12	9606.ENSP00000406674	0.748	2-acylglycerol O-acyltransferase 1
13	9606.ENSP00000285518	0.745	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
14	9606.ENSP00000479636	0.741	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
15	9606.ENSP00000302177	0.739	Lysophospholipid acyltransferase 2
16	9606.ENSP00000482264	0.732	Diacylglycerol O-acyltransferase 1
17	9606.ENSP00000198801	0.728	2-acylglycerol O-acyltransferase 2
18	9606.ENSP00000228027	0.725	Diacylglycerol O-acyltransferase 2
19	9606.ENSP00000266505	0.725	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
20	9606.ENSP00000381140	0.724	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004143	0.999	diacylglycerol kinase activity
GO:0019899	0.932	enzyme binding
GO:0051020	0.538	GTPase binding
GO:0031267	0.493	small GTPase binding
GO:0098772	0.344	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0046486	0.978	glycerolipid metabolic process
GO:0007165	0.965	signal transduction
GO:0006793	0.940	phosphorus metabolic process
GO:0006650	0.931	glycerophospholipid metabolic process
GO:0045017	0.911	glycerolipid biosynthetic process
GO:0032501	0.893	multicellular organismal process
GO:0090407	0.827	organophosphate biosynthetic process
GO:0050817	0.802	coagulation
GO:0019222	0.776	regulation of metabolic process
GO:0046474	0.772	glycerophospholipid biosynthetic process
GO:0080090	0.743	regulation of primary metabolic process
GO:0065008	0.733	regulation of biological quality
GO:0006638	0.703	neutral lipid metabolic process
GO:0006950	0.595	response to stress
GO:0048519	0.574	negative regulation of biological process
GO:0046473	0.551	phosphatidic acid metabolic process
GO:0019216	0.504	regulation of lipid metabolic process
GO:0031323	0.487	regulation of cellular metabolic process
GO:0016310	0.487	phosphorylation
GO:0048518	0.429	positive regulation of biological process
GO:0006654	0.397	phosphatidic acid biosynthetic process
GO:0006639	0.385	acylglycerol metabolic process
GO:0048583	0.361	regulation of response to stimulus
GO:0006807	0.349	nitrogen compound metabolic process
GO:0048522	0.341	positive regulation of cellular process
GO:0023051	0.314	regulation of signaling
GO:0010646	0.313	regulation of cell communication
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0012505	0.993	endomembrane system
GO:0005654	0.990	nucleoplasm
GO:0005829	0.987	cytosol
GO:0016020	0.976	membrane
GO:0005886	0.962	plasma membrane
GO:0016604	0.924	nuclear body
GO:0031982	0.856	vesicle
GO:0016607	0.840	nuclear speck
GO:0031090	0.811	organelle membrane
GO:0097708	0.715	intracellular vesicle
GO:0043232	0.696	intracellular non-membrane-bounded organelle
GO:0031410	0.642	cytoplasmic vesicle
GO:0030659	0.345	cytoplasmic vesicle membrane
GO:0005768	0.316	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	0.999	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	0.999	diacylglycerol kinase (ATP).

[back to server]