StarFunc result for job id P52848

User Input

>input (882 residues)
MPALACLRRLCRHVSPQAVLFLLFIFCLFSVFISAYYLYGWKRGLEPSADAPEPDCGDPP
PVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKG
DMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYGVGIIGFFKANENSLLSA
QLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPGEDWTVFQSNHSTYEPVLL
AKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLFGNNLNFWLHKLVFVDAVAF
LTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFDTQNELRAHIPNFTFNLGYSG
KFFHTGTNAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLFHNQSVLAEQMALNKKFAVEHG
IPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWSIRVTSTEEYPHLKPARYRRGFIHNGIMV
LPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLTVLLNPISIFMTHLSNYGNDRLGL
YTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSEEKDPLWQDPCEDKRHKDIWSKEKT
CDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYPSSETFEEIQFFNGHNYHKGIDWYME
FFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALLPKAKVLTILINPADRAYSWYQHQRAH
DDPVALKYTFHEVITAGSDASSKLRALQNRCLVPGWYATHIERWLSAYHANQILVLDGKL
LRTEPAKVMDMVQKFLGVTNTIDYHKTLAFDPKKGFWCQLLEGGKTKCLGKSKGRKYPEM
DLDSRAFLKDYYRDHNIELSKLLYKMGQTLPTWLREDLQNTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IR84	0.904	0.900	0.000	886	0.804	0.800	A0A0R4IR84.pdb.gz	A0A0R4IR84_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=fj47c03 PE=1 SV=1
2	AFDB:A0A2R8RQ45	0.906	0.890	0.000	898	0.721	0.708	A0A2R8RQ45.pdb.gz
3	AFDB:O95803	0.927	0.936	0.000	873	0.704	0.711	O95803.pdb.gz	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
4	AFDB:P52848	1.000	1.000	0.000	882	1.000	1.000	P52848.pdb.gz	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
5	AFDB:P52849	0.918	0.917	0.000	883	0.701	0.700	P52849.pdb.gz	NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=NDST2 PE=1 SV=1
6	AFDB:Q9EQW8	0.929	0.940	0.000	872	0.697	0.705	Q9EQW8.pdb.gz	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
7	AFDB:Q9V3L1	0.882	0.745	0.000	1048	0.529	0.446	Q9V3L1.pdb.gz	NDST_DROME Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=sfl PE=1 SV=1
8	AFDB:Q5B926	0.418	0.406	2.846E-18	912	0.096	0.093	Q5B926.pdb.gz	Q5B926_EMENI Extracellular serine-rich protein, putative (AFU_orthologue AFUA_3G07870) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02954 PE=4 SV=1
9	AFDB:A0MGZ3	0.266	0.729	3.004E-18	309	0.090	0.256	A0MGZ3.pdb.gz	A0MGZ3_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st7 PE=2 SV=1
10	AFDB:Q4TTA0	0.278	0.808	7.528E-18	291	0.093	0.282	Q4TTA0.pdb.gz	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
11	PDB:7scdA	0.269	0.613	4.891E-17	371	0.101	0.240	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
12	PDB:1zrhA	0.267	0.848	9.874E-17	263	0.082	0.274	1zrhA.pdb.gz	Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
13	PDB:4wioA	0.177	0.271	3.486E-5	525	0.052	0.088	4wioA.pdb.gz	Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
14	PDB:1gpmA	0.138	0.224	6.667E-5	501	0.043	0.076	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.
15	PDB:3uowB	0.127	0.214	1.145E-4	477	0.052	0.096	3uowB.pdb.gz	Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
16	PDB:5jm0A	0.178	0.169	2.119E-3	940	0.069	0.065	5jm0A.pdb.gz
17	PDB:3mgbA	0.130	0.326	2.630E-3	286	0.039	0.119	3mgbA.pdb.gz	Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
18	PDB:2ad1A	0.166	0.509	2.776E-3	244	0.044	0.160	2ad1A.pdb.gz
19	PDB:6rrnA	0.194	0.176	2.776E-3	989	0.044	0.039	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
20	PDB:2abwB	0.168	0.531	3.265E-3	226	0.019	0.075	2abwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IR84	0.0	1459	886	0.807	0.804	A0A0R4IR84_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=fj47c03 PE=1 SV=1
2	E7F0G2	0.0	1329	869	0.722	0.733	E7F0G2_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=ndst1a PE=3 SV=1
3	O95803	0.0	1324	873	0.704	0.711	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
4	P52848	0.0	1835	882	1.000	1.000	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
5	P52849	0.0	1303	883	0.681	0.681	NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=NDST2 PE=1 SV=1
6	P52850	0.0	1304	883	0.681	0.681	NDST2_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Ndst2 PE=1 SV=1
7	Q02353	0.0	1808	882	0.980	0.980	NDST1_RAT Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Rattus norvegicus OX=10116 GN=Ndst1 PE=1 SV=1
8	Q3UHN9	0.0	1804	882	0.977	0.977	NDST1_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Mus musculus OX=10090 GN=Ndst1 PE=1 SV=2
9	Q9EQH7	0.0	1307	873	0.693	0.700	NDST3_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Mus musculus OX=10090 GN=Ndst3 PE=2 SV=2
10	Q9EQW8	0.0	1326	872	0.694	0.702	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
11	Q9V3L1	0.0	974	1048	0.541	0.455	NDST_DROME Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=sfl PE=1 SV=1
12	Q4TTA0	7.31e-34	134	291	0.098	0.296	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
13	A0MGZ2	4.44e-30	124	334	0.101	0.266	A0MGZ2_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st6 PE=2 SV=1
14	Q9Y662	9.11e-30	124	390	0.096	0.218	HS3SB_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Homo sapiens OX=9606 GN=HS3ST3B1 PE=1 SV=1
15	Q9Y663	1.13e-29	124	406	0.096	0.209	HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Homo sapiens OX=9606 GN=HS3ST3A1 PE=1 SV=1
16	Q8BKN6	1.32e-29	124	393	0.100	0.224	HS3SA_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Mus musculus OX=10090 GN=Hs3st3a1 PE=2 SV=1
17	Q9QZS6	2.15e-29	123	390	0.100	0.226	HS3SB_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Mus musculus OX=10090 GN=Hs3st3b1 PE=2 SV=2
18	A0MGZ3	2.44e-29	121	309	0.102	0.291	A0MGZ3_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st7 PE=2 SV=1
19	Q96QI5	4.52e-29	121	342	0.093	0.240	HS3S6_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 6 OS=Homo sapiens OX=9606 GN=HS3ST6 PE=1 SV=2
20	Q29RB5	5.00e-29	120	303	0.098	0.284	Q29RB5_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=zgc:136835 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12062 HSNSD	3.1e-232	782.7	heparan sulfate-N-deacetylase
2	PF00685 Sulfotransfer_1	8.1e-42	155.1	Sulfotransferase domain
3	PF13469 Sulfotransfer_3	0.0013	30.7	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264039	0.960	Glypican-1
2	9606.ENSP00000359864	0.960	Glypican-4
3	9606.ENSP00000366246	0.959	Glypican-6
4	9606.ENSP00000366267	0.959	Glypican-5
5	9606.ENSP00000377836	0.959	Glypican-3
6	9606.ENSP00000292377	0.956	Glypican-2
7	9606.ENSP00000363827	0.956	Basement membrane-specific heparan sulfate proteoglycan core protein
8	9606.ENSP00000307046	0.951	Syndecan-2
9	9606.ENSP00000370542	0.946	Syndecan-1
10	9606.ENSP00000361818	0.944	Syndecan-4
11	9606.ENSP00000344468	0.941	Syndecan-3
12	9606.ENSP00000368678	0.941	Agrin
13	9606.ENSP00000379032	0.868	Exostosin-2
14	9606.ENSP00000261858	0.850	D-glucuronyl C5-epimerase
15	9606.ENSP00000359581	0.845	Heparan sulfate 2-O-sulfotransferase 1
16	9606.ENSP00000367446	0.837	Exostosin-1
17	9606.ENSP00000359579	0.781	Heparan sulfate 2-O-sulfotransferase 1
18	9606.ENSP00000259241	0.780	Heparan-sulfate 6-O-sulfotransferase 1
19	9606.ENSP00000220562	0.778	Exostosin-like 3
20	9606.ENSP00000265471	0.764	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019213	1.000	deacetylase activity
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0015016	1.000	[heparan sulfate]-glucosamine N-sulfotransferase activity
GO:0052689	0.993	carboxylic ester hydrolase activity
GO:0050119	0.975	N-acetylglucosamine deacetylase activity
GO:0005488	0.916	binding
GO:0005515	0.901	protein binding
GO:0102140	0.572	heparan sulfate N-deacetylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044272	0.995	sulfur compound biosynthetic process
GO:0006029	0.995	proteoglycan metabolic process
GO:0009101	0.995	glycoprotein biosynthetic process
GO:0030166	0.994	proteoglycan biosynthetic process
GO:0015012	0.982	heparan sulfate proteoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.989	membrane
GO:0031090	0.890	organelle membrane
GO:0098588	0.882	bounding membrane of organelle
GO:0000139	0.871	Golgi membrane
GO:0031984	0.574	organelle subcompartment
GO:0098791	0.304	Golgi apparatus subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
RHEA:21980	1.000	3'-phosphoadenylyl sulfate + alpha-D-glucosaminyl-[heparan sulfate](n) = adenosine 3',5'-bisphosphate + 2 H(+) + N-sulfo-alpha-D-glucosaminyl-[heparan sulfate](n)
EC:2.8.2.8	1.000	[heparan sulfate]-glucosamine N-sulfotransferase.
EC:3.1.1.-	0.993	Carboxylic ester hydrolases.
RHEA:20593	0.975	H2O + N-acetyl-D-glucosamine = acetate + D-glucosamine
EC:3.5.1.33	0.975	N-acetylglucosamine deacetylase.

[back to server]