StarFunc result for job id P52849

User Input

>input (883 residues)
MLQLWKVVRPARQLELHRLILLLIAFSLGSMGFLAYYVSTSPKAKEPLPLPLGDCSSGGA
AGPGPARPPVPPRPPRPPETARTEPVVLVFVESAYSQLGQEIVAILESSRFRYSTELAPG
RGDMPTLTDNTHGRYVLVIYENLLKYVNLDAWSRELLDRYCVEYGVGIIGFFRAHEHSLL
SAQLKGFPLFLHSNLGLRDYQVNPSAPLLHLTRPSRLEPGPLPGDDWTIFQSNHSTYEPV
LLASLRPAEPAVPGPVLRRARLPTVVQDLGLHDGIQRVLFGHGLSFWLHKLIFVDAVAYL
TGKRLCLDLDRYILVDIDDIFVGKEGTRMKVADVEALLTTQNKLRTLVPNFTFNLGFSGK
FYHTGTEEEDAGDDMLLKHRKEFWWFPHMWSHMQPHLFHNRSVLADQMRLNKQFALEHGI
PTDLGYAVAPHHSGVYPIHTQLYEAWKSVWGIQVTSTEEYPHLRPARYRRGFIHNGIMVL
PRQTCGLFTHTIFYNEYPGGSRELDRSIRGGELFLTVLLNPISIFMTHLSNYGNDRLGLY
TFESLVRFLQCWTRLRLQTLPPVPLAQKYFELFPQERSPLWQNPCDDKRHKDIWSKEKTC
DRLPKFLIVGPQKTGTTAIHFFLSLHPAVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDF
FPVPSNASTDFLFEKSATYFDSEVVPRRGAALLPRAKIITVLTNPADRAYSWYQHQRAHG
DPVALNYTFYQVISASSQTPLALRSLQNRCLVPGYYSTHLQRWLTYYPSGQLLIVDGQEL
RTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGFWCQGLEGGKTRCLGRSKGRRYPDMD
TESRLFLTDFFRNHNLELSKLLSRLGQPVPSWLREELQHSSLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IR84	0.892	0.889	0.000	886	0.707	0.704	A0A0R4IR84.pdb.gz	A0A0R4IR84_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=fj47c03 PE=1 SV=1
2	AFDB:A0A2R8RQ45	0.898	0.883	0.000	898	0.648	0.637	A0A2R8RQ45.pdb.gz
3	AFDB:O95803	0.893	0.903	0.000	873	0.648	0.655	O95803.pdb.gz	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
4	AFDB:P52848	0.926	0.927	0.000	882	0.698	0.698	P52848.pdb.gz	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
5	AFDB:P52849	1.000	1.000	0.000	883	1.000	1.000	P52849.pdb.gz	NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=NDST2 PE=1 SV=1
6	AFDB:Q9EQW8	0.907	0.918	0.000	872	0.657	0.665	Q9EQW8.pdb.gz	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
7	AFDB:Q9V3L1	0.892	0.756	0.000	1048	0.545	0.459	Q9V3L1.pdb.gz	NDST_DROME Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=sfl PE=1 SV=1
8	AFDB:Q4TTA0	0.275	0.797	6.609E-19	291	0.095	0.289	Q4TTA0.pdb.gz	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
9	AFDB:Q673U1	0.268	0.625	1.264E-18	367	0.100	0.240	Q673U1.pdb.gz	HS3S2_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Hs3st2 PE=2 SV=2
10	PDB:1zrhA	0.267	0.848	4.293E-18	263	0.083	0.278	1zrhA.pdb.gz	Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
11	AFDB:A0MGZ2	0.267	0.678	7.522E-18	334	0.095	0.251	A0MGZ2.pdb.gz	A0MGZ2_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st6 PE=2 SV=1
12	PDB:7scdA	0.267	0.611	2.697E-17	371	0.099	0.235	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
13	PDB:4wioA	0.168	0.260	2.142E-5	525	0.053	0.090	4wioA.pdb.gz	Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
14	PDB:3uowB	0.132	0.218	5.982E-5	477	0.054	0.101	3uowB.pdb.gz	Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
15	PDB:1gpmA	0.144	0.236	2.189E-4	501	0.043	0.076	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.
16	PDB:3p0bA	0.192	0.307	4.186E-4	511	0.049	0.084	3p0bA.pdb.gz
17	PDB:3mgcB	0.147	0.475	2.007E-3	227	0.037	0.145	3mgcB.pdb.gz	Crystal structures of the glycopeptide sulfotransferase Teg12 in a complex with the teicoplanin aglycone.
18	PDB:6rrnA	0.199	0.181	2.629E-3	989	0.048	0.042	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
19	PDB:7d50B	0.156	0.437	2.929E-3	255	0.033	0.114	7d50B.pdb.gz	Structure and mechanism of the gamma-glutamyl-gamma-aminobutyrate hydrolase SpuA from Pseudomonas aeruginosa.
20	PDB:2abwB	0.169	0.533	3.264E-3	226	0.018	0.071	2abwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IR84	0.0	1286	886	0.689	0.686	A0A0R4IR84_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=fj47c03 PE=1 SV=1
2	E7F0G2	0.0	1199	869	0.648	0.658	E7F0G2_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=ndst1a PE=3 SV=1
3	O95803	0.0	1243	873	0.642	0.649	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
4	P52848	0.0	1311	882	0.695	0.696	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
5	P52849	0.0	1820	883	1.000	1.000	NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=NDST2 PE=1 SV=1
6	P52850	0.0	1767	883	0.967	0.967	NDST2_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Ndst2 PE=1 SV=1
7	Q02353	0.0	1312	882	0.687	0.688	NDST1_RAT Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Rattus norvegicus OX=10116 GN=Ndst1 PE=1 SV=1
8	Q3UHN9	0.0	1315	882	0.691	0.692	NDST1_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Mus musculus OX=10090 GN=Ndst1 PE=1 SV=2
9	Q9EQH7	0.0	1243	873	0.649	0.656	NDST3_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Mus musculus OX=10090 GN=Ndst3 PE=2 SV=2
10	Q9EQW8	0.0	1253	872	0.652	0.661	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
11	Q9V3L1	0.0	1013	1048	0.546	0.460	NDST_DROME Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=sfl PE=1 SV=1
12	Q4TTA0	1.22e-33	133	291	0.096	0.292	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
13	Q8IZT8	1.09e-31	129	346	0.096	0.246	HS3S5_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 5 OS=Homo sapiens OX=9606 GN=HS3ST5 PE=1 SV=1
14	Q673U1	1.16e-31	129	367	0.099	0.237	HS3S2_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Hs3st2 PE=2 SV=2
15	Q80W66	1.16e-31	129	367	0.099	0.237	HS3S2_RAT Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Rattus norvegicus OX=10116 GN=Hs3st2 PE=1 SV=1
16	Q9Y278	2.62e-31	128	367	0.097	0.234	HS3S2_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=HS3ST2 PE=1 SV=1
17	Q8BKN6	1.02e-30	127	393	0.096	0.216	HS3SA_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Mus musculus OX=10090 GN=Hs3st3a1 PE=2 SV=1
18	Q9QZS6	2.00e-30	126	390	0.095	0.215	HS3SB_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Mus musculus OX=10090 GN=Hs3st3b1 PE=2 SV=2
19	Q9Y662	4.32e-30	125	390	0.104	0.236	HS3SB_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Homo sapiens OX=9606 GN=HS3ST3B1 PE=1 SV=1
20	Q9Y663	1.53e-29	124	406	0.091	0.197	HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Homo sapiens OX=9606 GN=HS3ST3A1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12062 HSNSD	3e-224	756.3	heparan sulfate-N-deacetylase
2	PF00685 Sulfotransfer_1	6.8e-42	155.4	Sulfotransferase domain
3	PF13469 Sulfotransfer_3	1.6e-07	43.5	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359864	0.955	Glypican-4
2	9606.ENSP00000264039	0.951	Glypican-1
3	9606.ENSP00000366267	0.951	Glypican-5
4	9606.ENSP00000377836	0.951	Glypican-3
5	9606.ENSP00000292377	0.949	Glypican-2
6	9606.ENSP00000366246	0.949	Glypican-6
7	9606.ENSP00000363827	0.941	Basement membrane-specific heparan sulfate proteoglycan core protein
8	9606.ENSP00000307046	0.940	Syndecan-2
9	9606.ENSP00000344468	0.936	Syndecan-3
10	9606.ENSP00000361818	0.934	Syndecan-4
11	9606.ENSP00000370542	0.932	Syndecan-1
12	9606.ENSP00000368678	0.928	Agrin
13	9606.ENSP00000296046	0.875	M14 carboxypeptidases
14	9606.ENSP00000261858	0.825	D-glucuronyl C5-epimerase
15	9606.ENSP00000379032	0.812	Exostosin-2
16	9606.ENSP00000363068	0.811	Protocadherin-15
17	9606.ENSP00000359581	0.810	Heparan sulfate 2-O-sulfotransferase 1
18	9606.ENSP00000367446	0.787	Exostosin-1
19	9606.ENSP00000259241	0.772	Heparan-sulfate 6-O-sulfotransferase 1
20	9606.ENSP00000359579	0.759	Heparan sulfate 2-O-sulfotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019213	1.000	deacetylase activity
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0015016	1.000	[heparan sulfate]-glucosamine N-sulfotransferase activity
GO:0050119	0.980	N-acetylglucosamine deacetylase activity
GO:0005488	0.772	binding
GO:0005515	0.755	protein binding
GO:0052689	0.721	carboxylic ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0019538	0.991	protein metabolic process
GO:1901135	0.990	carbohydrate derivative metabolic process
GO:0006790	0.988	sulfur compound metabolic process
GO:0006029	0.980	proteoglycan metabolic process
GO:0009101	0.978	glycoprotein biosynthetic process
GO:0030166	0.969	proteoglycan biosynthetic process
GO:0015012	0.959	heparan sulfate proteoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.989	membrane
GO:0031090	0.890	organelle membrane
GO:0098588	0.881	bounding membrane of organelle
GO:0000139	0.866	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
RHEA:21980	1.000	3'-phosphoadenylyl sulfate + alpha-D-glucosaminyl-[heparan sulfate](n) = adenosine 3',5'-bisphosphate + 2 H(+) + N-sulfo-alpha-D-glucosaminyl-[heparan sulfate](n)
EC:2.8.2.8	1.000	[heparan sulfate]-glucosamine N-sulfotransferase.
RHEA:20593	0.980	H2O + N-acetyl-D-glucosamine = acetate + D-glucosamine
EC:3.5.1.33	0.980	N-acetylglucosamine deacetylase.
EC:3.1.1.-	0.721	Carboxylic ester hydrolases.

[back to server]