StarFunc result for job id P52888

User Input

>input (689 residues)
MKPPAACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVS
YESTLKALADVEVTYTVQRNILDFPQHVSPSKDIRTASTEADKKLSEFDVEMSMREDVYQ
RIVWLQEKVQKDSLRPEAARYLERLIKLGRRNGLHLPRETQENIKRIKKKLSLLCIDFNK
NLNEDTTFLPFTLQELGGLPEDFLNSLEKMEDGKLKVTLKYPHYFPLLKKCHVPETRRKV
EEAFNCRCKEENCAILKELVTLRAQKSRLLGFHTHADYVLEMNMAKTSQTVATFLDELAQ
KLKPLGEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQVEETRYCVDQNLLKEYF
PVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREG
KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADAPSLLQHDEVETYFHEFGHVMH
QLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAVPRELLEKLI
ESRQANTGLFNLRQIVLAKVDQALHTQTDADPAEEYARLCQEILGVPATPGTNMPATFGH
LAGGYDAQYYGYLWSEVYSMDMFHTRFKQEGVLNSKVGMDYRSCILRPGGSEDASAMLRR
FLGRDPKQDAFLLSKGLQVGGCEPEPQVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52888	1.000	1.000	0.000	689	1.000	1.000	P52888.pdb.gz	THOP1_HUMAN Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2
2	AFDB:P24155	0.971	0.974	2.213E-96	687	0.882	0.885	P24155.pdb.gz	THOP1_RAT Thimet oligopeptidase OS=Rattus norvegicus OX=10116 GN=Thop1 PE=1 SV=4
3	PDB:2o36A	0.850	0.892	5.999E-89	654	0.942	0.992	2o36A.pdb.gz	Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase.
4	AFDB:P42676	0.937	0.917	2.624E-77	704	0.627	0.614	P42676.pdb.gz	NEUL_RAT Neurolysin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Nln PE=1 SV=1
5	AFDB:Q02038	0.948	0.928	3.263E-77	704	0.626	0.612	Q02038.pdb.gz	NEUL_PIG Neurolysin, mitochondrial OS=Sus scrofa OX=9823 GN=NLN PE=1 SV=1
6	PDB:5lv0A	0.957	0.990	2.208E-74	666	0.617	0.638	5lv0A.pdb.gz	Structural and functional analysis of Neurolysin, a new component of the mitochondrial peptidolytic network
7	AFDB:P25375	0.932	0.903	7.069E-54	712	0.363	0.351	P25375.pdb.gz	PRTD_YEAST Saccharolysin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRD1 PE=1 SV=1
8	AFDB:P27298	0.902	0.914	4.055E-43	680	0.293	0.297	P27298.pdb.gz	OPDA_ECOLI Oligopeptidase A OS=Escherichia coli (strain K12) OX=83333 GN=prlC PE=3 SV=3
9	AFDB:F4KDA5	0.827	0.808	3.499E-40	706	0.241	0.235	F4KDA5.pdb.gz	MIP_ARATH Mitochondrial intermediate peptidase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OCT1 PE=3 SV=1
10	AFDB:Q94AM1	0.896	0.784	5.181E-40	791	0.267	0.233	Q94AM1.pdb.gz	OOPDA_ARATH Organellar oligopeptidase A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OOP PE=1 SV=1
11	PDB:4ka7A	0.885	0.877	1.517E-38	695	0.258	0.256	4ka7A.pdb.gz	Organellar oligopeptidase (OOP) provides a complementary pathway for targeting peptide degradation in mitochondria and chloroplasts.
12	AFDB:Q99797	0.794	0.770	4.096E-37	713	0.225	0.217	Q99797.pdb.gz	MIPEP_HUMAN Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2
13	AFDB:A6H611	0.800	0.777	4.470E-37	711	0.219	0.212	A6H611.pdb.gz	MIPEP_MOUSE Mitochondrial intermediate peptidase OS=Mus musculus OX=10090 GN=Mipep PE=1 SV=1
14	PDB:1y791	0.866	0.877	5.470E-36	680	0.247	0.250	1y791.pdb.gz	Crystal Structure of the E.coli Dipeptidyl Carboxypeptidase Dcp: Further Indication of a Ligand-dependant Hinge Movement Mechanism
15	PDB:5a2rA	0.599	0.681	9.613E-12	597	0.128	0.147	5a2rA.pdb.gz	A New High-Resolution Crystal Structure of the Drosophila Melanogaster Angiotensin Converting Enzyme Homologue, Ance.
16	PDB:3hq2B	0.493	0.661	7.870E-10	497	0.109	0.151	3hq2B.pdb.gz	Insight into the substrate length restriction of M32 carboxypeptidases: Characterization of two distinct subfamilies.
17	PDB:7v61B	0.482	0.450	7.870E-10	751	0.139	0.128	7v61B.pdb.gz
18	PDB:7c8jA	0.513	0.501	1.165E-9	707	0.141	0.137	7c8jA.pdb.gz	Cross-species recognition of SARS-CoV-2 to bat ACE2.
19	PDB:1ka2A	0.444	0.588	4.312E-9	497	0.132	0.183	1ka2A.pdb.gz	Crystal Structure of a Novel Carboxypeptidase from the Hyperthermophilic Archaeon Pyrococcus furiosus
20	PDB:5wvuA	0.496	0.646	4.504E-9	510	0.135	0.182	5wvuA.pdb.gz	Insight into the transition between the open and closed conformations of Thermus thermophilus carboxypeptidase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24155	0.0	1284	687	0.884	0.886	THOP1_RAT Thimet oligopeptidase OS=Rattus norvegicus OX=10116 GN=Thop1 PE=1 SV=4
2	P42676	0.0	903	704	0.621	0.608	NEUL_RAT Neurolysin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Nln PE=1 SV=1
3	P52888	0.0	1439	689	1.000	1.000	THOP1_HUMAN Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2
4	Q02038	0.0	910	704	0.621	0.608	NEUL_PIG Neurolysin, mitochondrial OS=Sus scrofa OX=9823 GN=NLN PE=1 SV=1
5	Q8C1A5	0.0	1284	687	0.887	0.889	THOP1_MOUSE Thimet oligopeptidase OS=Mus musculus OX=10090 GN=Thop1 PE=1 SV=1
6	Q91YP2	0.0	910	704	0.631	0.618	NEUL_MOUSE Neurolysin, mitochondrial OS=Mus musculus OX=10090 GN=Nln PE=1 SV=1
7	Q96CV8	0.0	1437	689	0.999	0.999	Q96CV8_HUMAN Thimet oligopeptidase 1 OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=1
8	Q9BYT8	0.0	902	704	0.618	0.605	NEUL_HUMAN Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1
9	P25375	4.03e-142	434	712	0.367	0.355	PRTD_YEAST Saccharolysin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRD1 PE=1 SV=1
10	P27298	3.97e-96	313	680	0.295	0.299	OPDA_ECOLI Oligopeptidase A OS=Escherichia coli (strain K12) OX=83333 GN=prlC PE=3 SV=3
11	Q94AM1	6.00e-76	261	791	0.260	0.226	OOPDA_ARATH Organellar oligopeptidase A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OOP PE=1 SV=1
12	Q949P2	6.24e-75	257	701	0.263	0.258	COPDA_ARATH Probable cytosolic oligopeptidase A OS=Arabidopsis thaliana OX=3702 GN=CYOP PE=1 SV=1
13	F4KDA5	1.12e-64	229	706	0.238	0.232	MIP_ARATH Mitochondrial intermediate peptidase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OCT1 PE=3 SV=1
14	P24171	7.29e-54	198	681	0.245	0.248	DCP_ECOLI Dipeptidyl carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=dcp PE=1 SV=4
15	Q99797	6.26e-52	193	713	0.234	0.226	MIPEP_HUMAN Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2
16	A6H611	7.27e-48	182	711	0.215	0.208	MIPEP_MOUSE Mitochondrial intermediate peptidase OS=Mus musculus OX=10090 GN=Mipep PE=1 SV=1
17	Q01992	8.11e-44	170	710	0.216	0.210	MIPEP_RAT Mitochondrial intermediate peptidase OS=Rattus norvegicus OX=10116 GN=Mipep PE=1 SV=1
18	Q10415	1.23e-39	158	762	0.219	0.198	PMIP_SCHPO Mitochondrial intermediate peptidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oct1 PE=3 SV=1
19	P35999	4.04e-39	156	772	0.208	0.185	PMIP_YEAST Mitochondrial intermediate peptidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCT1 PE=1 SV=2
20	Q389Z4	1.11e-24	111	675	0.168	0.172	Q389Z4_TRYB2 Mitochondrial intermediate peptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0490 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01432 Peptidase_M3	1.1e-157	537.6	Peptidase family M3
2	PF19310 TOP_N	98	14.2	Neurolysin/Thimet oligopeptidase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265023	0.943	Kininogen-1
2	9606.ENSP00000264335	0.823	14-3-3 protein epsilon
3	9606.ENSP00000231368	0.788	Leucyl-cystinyl aminopeptidase
4	9606.ENSP00000358106	0.781	Prolyl endopeptidase
5	9606.ENSP00000258301	0.721	Syntaxin-6
6	9606.ENSP00000261714	0.711	Bleomycin hydrolase
7	9606.ENSP00000418525	0.692	Neprilysin
8	9606.ENSP00000290866	0.685	Angiotensin-converting enzyme
9	9606.ENSP00000300289	0.684	Protein disulfide-isomerase A3
10	9606.ENSP00000338039	0.678	Proteasome inhibitor PI31 subunit
11	9606.ENSP00000389326	0.678	Angiotensin-converting enzyme 2
12	9606.ENSP00000404833	0.676	Tapasin
13	9606.ENSP00000320866	0.671	Calreticulin
14	9606.ENSP00000387760	0.671	Angiotensin-converting enzyme
15	9606.ENSP00000256010	0.662	Neurotensin/neuromedin N
16	9606.ENSP00000339477	0.660	Inducible T-cell co-stimulator ligand
17	9606.ENSP00000483732	0.660	ICOS ligand
18	9606.ENSP00000331600	0.654	Probable G-protein coupled receptor 173
19	9606.ENSP00000265986	0.650	Insulin-degrading enzyme
20	9606.ENSP00000312002	0.649	Hepatitis A virus cellular receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:1901564	0.992	organonitrogen compound metabolic process
GO:0044238	0.990	primary metabolic process
GO:0009987	0.964	cellular process
GO:0043170	0.893	macromolecule metabolic process
GO:0019538	0.882	protein metabolic process
GO:0065007	0.691	biological regulation
GO:0050789	0.620	regulation of biological process
GO:0050794	0.525	regulation of cellular process
GO:0044237	0.478	cellular metabolic process
GO:0006508	0.447	proteolysis
GO:0050896	0.344	response to stimulus
GO:0043603	0.300	amide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043226	0.921	organelle
GO:0043227	0.912	membrane-bounded organelle
GO:0043229	0.905	intracellular organelle
GO:0043231	0.895	intracellular membrane-bounded organelle
GO:0005576	0.853	extracellular region
GO:0016020	0.842	membrane
GO:0071944	0.637	cell periphery
GO:0005739	0.556	mitochondrion
GO:0005886	0.363	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]