StarFunc result for job id P52926

User Input

>input (109 residues)
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52926	1.000	1.000	4.121E-15	109	1.000	1.000	P52926.pdb.gz	HMGA2_HUMAN High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1
2	AFDB:P0CI01	0.132	0.045	4.036	402	0.275	0.075	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
3	AFDB:Q8RWQ1	0.153	0.034	8.202	809	0.266	0.036	Q8RWQ1.pdb.gz	Q8RWQ1_ARATH At2g44720/F16B22.21 OS=Arabidopsis thaliana OX=3702 GN=At2g44710 PE=1 SV=1
4	AFDB:P51979	0.175	0.028	9.603	1187	0.156	0.014	P51979.pdb.gz	HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFM1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52926	4.36e-67	199	109	1.000	1.000	HMGA2_HUMAN High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1
2	P52927	4.31e-62	186	108	0.954	0.963	HMGA2_MOUSE High mobility group protein HMGI-C OS=Mus musculus OX=10090 GN=Hmga2 PE=1 SV=1
3	O88791	3.85e-58	176	107	0.927	0.944	O88791_RAT High mobility group AT-hook 2 OS=Rattus norvegicus OX=10116 GN=Hmga2 PE=1 SV=1
4	A0A8I6A172	2.13e-45	144	101	0.716	0.772	A0A8I6A172_RAT High mobility group AT-hook 2 OS=Rattus norvegicus OX=10116 GN=Hmga2 PE=3 SV=1
5	A0A8I6GCP7	4.80e-35	118	128	0.578	0.492	A0A8I6GCP7_RAT High mobility group AT-hook 2 OS=Rattus norvegicus OX=10116 GN=Hmga2 PE=3 SV=1
6	E9QD31	2.98e-10	54.7	100	0.339	0.370	E9QD31_DANRE High mobility group AT-hook 1a OS=Danio rerio OX=7955 GN=hmga1 PE=1 SV=1
7	Q6NV11	1.12e-09	53.1	101	0.349	0.376	Q6NV11_DANRE High mobility group AT-hook 1a OS=Danio rerio OX=7955 GN=zgc:85677 PE=1 SV=1
8	P17095	2.32e-09	52.4	107	0.413	0.421	HMGA1_MOUSE High mobility group protein HMG-I/HMG-Y OS=Mus musculus OX=10090 GN=Hmga1 PE=1 SV=4
9	P17096	9.48e-07	45.8	107	0.312	0.318	HMGA1_HUMAN High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3
10	Q9FYS5	0.001	38.5	193	0.303	0.171	HMGYA_MAIZE HMG-Y-related protein A OS=Zea mays OX=4577 GN=HMGIY2 PE=1 SV=1
11	Q9Y794	0.001	39.3	972	0.367	0.041	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
12	G5EDQ2	0.021	35.4	315	0.284	0.098	HMG12_CAEEL High mobility group protein hmg-12 OS=Caenorhabditis elegans OX=6239 GN=hmg-12 PE=1 SV=1
13	O97267	0.22	32.7	2114	0.165	0.009	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
14	Q9VQI9	0.42	31.6	1673	0.156	0.010	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
15	A0AVW1	0.58	31.2	1066	0.211	0.022	A0AVW1_DROME IP13255p OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
16	P51123	0.59	31.2	2129	0.275	0.014	TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster OX=7227 GN=Taf1 PE=1 SV=3
17	Q9V3K8	1.3	30.4	1624	0.303	0.020	Q9V3K8_DROME EG:BACR37P7.2 protein OS=Drosophila melanogaster OX=7227 GN=G9a PE=4 SV=1
18	M9PGH7	1.4	30.4	1657	0.303	0.020	M9PGH7_DROME G9a, isoform B OS=Drosophila melanogaster OX=7227 GN=G9a PE=1 SV=1
19	Q95RU8	1.4	30.0	1637	0.303	0.020	Q95RU8_DROME G9a, isoform A OS=Drosophila melanogaster OX=7227 GN=G9a PE=1 SV=1
20	Q4QXM3	2.0	29.6	1323	0.257	0.021	PD5AA_XENLA Sister chromatid cohesion protein PDS5 homolog A-A OS=Xenopus laevis OX=8355 GN=pds5a-a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02178 AT_hook	0.034	24.9	AT hook motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007447448.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007448196.1	0.958	SMAD family member 3
2	118797.XP_007465665.1	0.934	SMAD family member 2
3	118797.XP_007466499.1	0.932	RB transcriptional corepressor 1
4	118797.XP_007465628.1	0.930	SMAD family member 4
5	118797.XP_007457852.1	0.842	Cellular tumor antigen p53 isoform X1
6	118797.XP_007464298.1	0.757	SMAD family member 9
7	118797.XP_007463792.1	0.692	Belongs to the intermediate filament family.
8	118797.XP_007447793.1	0.650	RB transcriptional corepressor like 1
9	118797.XP_007459522.1	0.650	RB transcriptional corepressor like 2
10	118797.XP_007462857.1	0.636	E1A-binding protein p400
11	118797.XP_007461451.1	0.626	SMAD family member 5
12	118797.XP_007466960.1	0.625	SMAD family member 1
13	118797.XP_007465833.1	0.602	Lin-28 homolog B
14	118797.XP_007462476.1	0.598	Zinc finger and AT-hook domain containing
15	118797.XP_007451449.1	0.594	Insulin-like growth factor 2 mRNA-binding protein 2 isoform X1
16	118797.XP_007448494.1	0.592	LIM domain containing preferred translocation partner in lipoma
17	118797.XP_007459176.1	0.589	Protein lin-28 homolog A
18	118797.XP_007457662.1	0.581	Zinc finger protein 217
19	118797.XP_007467806.1	0.574	Sulfite oxidase
20	118797.XP_007457231.1	0.566	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003680	1.000	minor groove of adenine-thymine-rich DNA binding
GO:0043565	0.984	sequence-specific DNA binding
GO:1990837	0.967	sequence-specific double-stranded DNA binding
GO:0140110	0.925	transcription regulator activity
GO:0000976	0.901	transcription cis-regulatory region binding
GO:0019904	0.899	protein domain specific binding
GO:0003682	0.897	chromatin binding
GO:0000987	0.893	cis-regulatory region sequence-specific DNA binding
GO:0031491	0.888	nucleosome binding
GO:0031490	0.888	chromatin DNA binding
GO:0003906	0.886	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0000977	0.886	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003712	0.870	transcription coregulator activity
GO:0031492	0.870	nucleosomal DNA binding
GO:0016829	0.868	lyase activity
GO:0000978	0.858	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008301	0.845	DNA binding, bending
GO:0016835	0.833	carbon-oxygen lyase activity
GO:0140297	0.830	DNA-binding transcription factor binding
GO:0046332	0.824	SMAD binding
GO:0061629	0.768	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003714	0.734	transcription corepressor activity
GO:0051575	0.581	5'-deoxyribose-5-phosphate lyase activity
GO:0070742	0.572	C2H2 zinc finger domain binding
GO:0035501	0.572	MH1 domain binding
GO:0035500	0.572	MH2 domain binding
GO:0035497	0.572	cAMP response element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0006355	0.994	regulation of DNA-templated transcription
GO:0050896	0.982	response to stimulus
GO:0048523	0.955	negative regulation of cellular process
GO:0009987	0.931	cellular process
GO:0031324	0.920	negative regulation of cellular metabolic process
GO:0006357	0.825	regulation of transcription by RNA polymerase II
GO:0048518	0.823	positive regulation of biological process
GO:0010558	0.784	negative regulation of macromolecule biosynthetic process
GO:0031327	0.783	negative regulation of cellular biosynthetic process
GO:0065009	0.729	regulation of molecular function
GO:1903507	0.701	negative regulation of nucleic acid-templated transcription
GO:0045892	0.694	negative regulation of DNA-templated transcription
GO:0007154	0.610	cell communication
GO:0051716	0.607	cellular response to stimulus
GO:0044093	0.591	positive regulation of molecular function
GO:0048522	0.555	positive regulation of cellular process
GO:0023052	0.540	signaling
GO:0032879	0.462	regulation of localization
GO:0048583	0.461	regulation of response to stimulus
GO:0048585	0.326	negative regulation of response to stimulus
GO:0008283	0.324	cell population proliferation
GO:0009893	0.323	positive regulation of metabolic process
GO:0032502	0.319	developmental process
GO:0051049	0.313	regulation of transport
GO:0032501	0.306	multicellular organismal process
GO:0048856	0.303	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0070013	0.993	intracellular organelle lumen
GO:0031981	0.982	nuclear lumen
GO:0032991	0.957	protein-containing complex
GO:0005694	0.899	chromosome
GO:0000785	0.454	chromatin
GO:0005737	0.449	cytoplasm
GO:0005654	0.389	nucleoplasm
GO:0035985	0.387	senescence-associated heterochromatin focus
GO:0071141	0.305	SMAD protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.-.-.-	0.868	Lyases.
EC:4.2.-.-	0.833	Carbon-oxygen lyases.

[back to server]