StarFunc result for job id P52945

User Input

>input (283 residues)
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG
SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP
WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA
VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP
PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52945	0.999	0.999	2.125E-42	283	1.000	1.000	P52945.pdb.gz	PDX1_HUMAN Pancreas/duodenum homeobox protein 1 OS=Homo sapiens OX=9606 GN=PDX1 PE=1 SV=1
2	AFDB:P52946	0.474	0.472	4.343E-34	284	0.880	0.877	P52946.pdb.gz	PDX1_MOUSE Pancreas/duodenum homeobox protein 1 OS=Mus musculus OX=10090 GN=Pdx1 PE=1 SV=1
3	AFDB:P09630	0.270	0.321	4.055E-10	235	0.247	0.298	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
4	AFDB:Q9H4S2	0.246	0.263	1.698E-9	264	0.286	0.307	Q9H4S2.pdb.gz	GSX1_HUMAN GS homeobox 1 OS=Homo sapiens OX=9606 GN=GSX1 PE=1 SV=1
5	AFDB:A0A024RA33	0.292	0.191	2.202E-9	443	0.343	0.219	A0A024RA33.pdb.gz
6	AFDB:P09027	0.285	0.192	2.350E-9	433	0.353	0.231	P09027.pdb.gz	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
7	AFDB:P18111	0.304	0.320	2.857E-9	268	0.293	0.310	P18111.pdb.gz	CDX1_MOUSE Homeobox protein CDX-1 OS=Mus musculus OX=10090 GN=Cdx1 PE=1 SV=2
8	AFDB:A5PLE8	0.259	0.284	3.707E-9	255	0.244	0.271	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
9	AFDB:A8KBT9	0.262	0.273	3.707E-9	270	0.254	0.267	A8KBT9.pdb.gz	A8KBT9_DANRE Caudal type homeo box transcription factor 4 OS=Danio rerio OX=7955 GN=CHUNP6923 PE=2 SV=1
10	AFDB:P47902	0.270	0.287	3.707E-9	265	0.283	0.302	P47902.pdb.gz	CDX1_HUMAN Homeobox protein CDX-1 OS=Homo sapiens OX=9606 GN=CDX1 PE=1 SV=2
11	PDB:2hi3A	0.186	0.632	1.842E-2	73	0.067	0.260	2hi3A.pdb.gz
12	PDB:4egcA	0.175	0.092	1.965E-2	539	0.053	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.137	0.229	5.799E-1	153	0.035	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.140	0.393	8.029E-1	86	0.035	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:6v7wE	0.098	0.114	9.761E-1	234	0.049	0.060	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
16	PDB:2cg4A	0.117	0.210	1.266	149	0.035	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:5nr5A	0.143	0.320	1.539	113	0.053	0.133	5nr5A.pdb.gz
18	PDB:5ds9B	0.117	0.273	1.753	98	0.042	0.122	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
19	PDB:5mrca	0.136	0.200	1.753	177	0.057	0.090	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
20	PDB:1gjqA	0.080	0.050	1.871	541	0.028	0.015	1gjqA.pdb.gz	Cyanide Binding to Cd(1) Nitrite Reductase from Pseudomonas Aeruginosa: Role of the Active-Site His369 in Ligand Stabilization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52945	0.0	562	283	1.000	1.000	PDX1_HUMAN Pancreas/duodenum homeobox protein 1 OS=Homo sapiens OX=9606 GN=PDX1 PE=1 SV=1
2	P52947	3.32e-159	446	283	0.887	0.887	PDX1_RAT Pancreas/duodenum homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Pdx1 PE=1 SV=1
3	P52946	3.74e-151	426	284	0.880	0.877	PDX1_MOUSE Pancreas/duodenum homeobox protein 1 OS=Mus musculus OX=10090 GN=Pdx1 PE=1 SV=1
4	Q6DC85	1.06e-78	240	246	0.477	0.549	Q6DC85_DANRE Pancreas/duodenum homeobox protein 1 OS=Danio rerio OX=7955 GN=ipf1 PE=2 SV=1
5	P02831	1.50e-29	118	443	0.212	0.135	HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2
6	O43365	1.14e-28	115	443	0.208	0.133	HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens OX=9606 GN=HOXA3 PE=1 SV=1
7	P31249	2.00e-28	114	432	0.191	0.125	HXD3_HUMAN Homeobox protein Hox-D3 OS=Homo sapiens OX=9606 GN=HOXD3 PE=1 SV=3
8	P09027	5.71e-28	113	433	0.191	0.125	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
9	P06798	1.09e-27	110	285	0.219	0.218	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
10	Q8AWZ2	1.48e-26	109	410	0.184	0.127	HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio OX=7955 GN=hoxa3a PE=2 SV=1
11	P10628	1.83e-26	105	250	0.173	0.196	HXD4_MOUSE Homeobox protein Hox-D4 OS=Mus musculus OX=10090 GN=Hoxd4 PE=1 SV=3
12	O57374	2.69e-26	105	236	0.198	0.237	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
13	P09016	3.13e-26	105	255	0.173	0.192	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
14	P14651	3.99e-26	108	431	0.170	0.111	HXB3_HUMAN Homeobox protein Hox-B3 OS=Homo sapiens OX=9606 GN=HOXB3 PE=2 SV=2
15	P09026	4.41e-26	108	433	0.170	0.111	HXB3_MOUSE Homeobox protein Hox-B3 OS=Mus musculus OX=10090 GN=Hoxb3 PE=2 SV=4
16	Q00056	7.02e-26	105	320	0.173	0.153	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
17	H0YHX3	7.67e-26	101	140	0.173	0.350	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
18	Q08624	8.38e-26	104	264	0.170	0.182	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
19	P10284	9.61e-26	103	250	0.173	0.196	HXB4_MOUSE Homeobox protein Hox-B4 OS=Mus musculus OX=10090 GN=Hoxb4 PE=2 SV=1
20	P09017	9.69e-26	104	264	0.170	0.182	HXC4_HUMAN Homeobox protein Hox-C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	3e-18	76.7	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328364	0.989	Transcription factor MafA
2	9606.ENSP00000380432	0.977	Insulin
3	9606.ENSP00000223366	0.972	Glucokinase
4	9606.ENSP00000240652	0.971	Islet amyloid polypeptide
5	9606.ENSP00000400341	0.970	Hepatocyte nuclear factor 3-beta
6	9606.ENSP00000302630	0.961	Hepatocyte nuclear factor 6
7	9606.ENSP00000368880	0.952	Forkhead box protein O1
8	9606.ENSP00000356331	0.943	Nuclear receptor subfamily 5 group A member 2
9	9606.ENSP00000295886	0.940	Homeobox protein Nkx-6.1
10	9606.ENSP00000264664	0.933	Fibroblast growth factor 10
11	9606.ENSP00000404100	0.928	Paired box protein Pax-6
12	9606.ENSP00000242462	0.866	Neurogenin-3
13	9606.ENSP00000365687	0.858	Pancreas transcription factor 1 subunit alpha
14	9606.ENSP00000295108	0.835	Neurogenic differentiation factor 1
15	9606.ENSP00000405890	0.833	Pre-B-cell leukemia transcription factor 1
16	9606.ENSP00000263253	0.801	Histone acetyltransferase p300
17	9606.ENSP00000309591	0.800	cAMP-dependent protein kinase catalytic subunit alpha
18	9606.ENSP00000359719	0.800	cAMP-dependent protein kinase catalytic subunit beta
19	9606.ENSP00000366488	0.800	cAMP-dependent protein kinase catalytic subunit gamma
20	9606.ENSP00000323568	0.790	Solute carrier family 2, facilitated glucose transporter member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.983	protein binding
GO:0000981	0.904	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.790	transcription cis-regulatory region binding
GO:0000977	0.665	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0032501	0.990	multicellular organismal process
GO:0009987	0.990	cellular process
GO:0032502	0.985	developmental process
GO:0050794	0.983	regulation of cellular process
GO:0048856	0.981	anatomical structure development
GO:0048513	0.961	animal organ development
GO:0007275	0.955	multicellular organism development
GO:0048731	0.876	system development
GO:0019222	0.871	regulation of metabolic process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0031016	0.823	pancreas development
GO:0080090	0.791	regulation of primary metabolic process
GO:0030154	0.785	cell differentiation
GO:0048518	0.769	positive regulation of biological process
GO:0031323	0.757	regulation of cellular metabolic process
GO:0010468	0.735	regulation of gene expression
GO:0051171	0.724	regulation of nitrogen compound metabolic process
GO:0009889	0.693	regulation of biosynthetic process
GO:0048522	0.687	positive regulation of cellular process
GO:0031326	0.665	regulation of cellular biosynthetic process
GO:0050896	0.640	response to stimulus
GO:0010556	0.640	regulation of macromolecule biosynthetic process
GO:0019219	0.620	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.580	positive regulation of macromolecule metabolic process
GO:0006355	0.558	regulation of DNA-templated transcription
GO:0008152	0.550	metabolic process
GO:0035270	0.539	endocrine system development
GO:0071704	0.529	organic substance metabolic process
GO:0031325	0.521	positive regulation of cellular metabolic process
GO:0044238	0.514	primary metabolic process
GO:0007154	0.465	cell communication
GO:0009888	0.448	tissue development
GO:0023052	0.447	signaling
GO:0051173	0.444	positive regulation of nitrogen compound metabolic process
GO:0065008	0.441	regulation of biological quality
GO:0051716	0.436	cellular response to stimulus
GO:0010557	0.429	positive regulation of macromolecule biosynthetic process
GO:0031328	0.428	positive regulation of cellular biosynthetic process
GO:0045935	0.413	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.411	regulation of transcription by RNA polymerase II
GO:0045893	0.402	positive regulation of DNA-templated transcription
GO:0006807	0.335	nitrogen compound metabolic process
GO:0045944	0.322	positive regulation of transcription by RNA polymerase II
GO:0007165	0.305	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.683	cytoplasm
GO:0005829	0.474	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]