StarFunc result for job id P52948

User Input

>input (1817 residues)
MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPG
GLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNF
GTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVST
NISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGL
FSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF
SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAV
GSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIF
GSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFG
APQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAA
QKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
VLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDRE
EIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGD
VNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTS
TKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLD
TMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIP
STSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMG
RSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDL
PEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEE
EVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTA
SISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYS
DRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEG
LWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAK
AVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERS
SLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKD
RLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDE
LRSLTQSYLRELAVGSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F981	0.381	0.381	0.000	1814	0.619	0.620	E7F981.pdb.gz	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
2	AFDB:P52948	1.000	1.000	0.000	1817	1.000	1.000	P52948.pdb.gz	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
3	AFDB:Q9VCH5	0.338	0.315	5.084E-80	1960	0.333	0.309	Q9VCH5.pdb.gz	NUP98_DROME Nuclear pore complex protein Nup98-Nup96 OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=1 SV=3
4	AFDB:G5EEH9	0.255	0.275	7.654E-54	1678	0.250	0.271	G5EEH9.pdb.gz	NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans OX=6239 GN=npp-10 PE=1 SV=1
5	AFDB:Q9UTK4	0.272	0.274	3.092E-49	1807	0.248	0.249	Q9UTK4.pdb.gz	NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup189 PE=1 SV=2
6	AFDB:G0SAK3	0.240	0.243	2.024E-42	1793	0.254	0.257	G0SAK3.pdb.gz	NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP145 PE=1 SV=1
7	AFDB:Q6DCP4	0.042	0.105	2.109E-32	647	0.245	0.689	Q6DCP4.pdb.gz	Q6DCP4_XENLA Nup98 protein (Fragment) OS=Xenopus laevis OX=8355 GN=Nup98 PE=2 SV=1
8	AFDB:F4ID16	0.083	0.150	1.102E-17	997	0.145	0.264	F4ID16.pdb.gz	NU98B_ARATH Nuclear pore complex protein NUP98B OS=Arabidopsis thaliana OX=3702 GN=NUP98B PE=1 SV=1
9	AFDB:Q8RY25	0.084	0.146	8.728E-17	1041	0.138	0.241	Q8RY25.pdb.gz	NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana OX=3702 GN=NUP98A PE=1 SV=1
10	AFDB:Q02629	0.076	0.139	3.098E-12	959	0.127	0.241	Q02629.pdb.gz	NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP100 PE=1 SV=1
11	PDB:3jroA	0.180	0.433	2.725E-9	701	0.047	0.123	3jroA.pdb.gz
12	PDB:4xmmD	0.181	0.416	6.971E-6	620	0.042	0.123	4xmmD.pdb.gz
13	PDB:7fikB	0.199	0.500	1.253E-4	598	0.052	0.159	7fikB.pdb.gz
14	PDB:7tdzC	0.200	0.458	1.426E-4	653	0.057	0.158	7tdzC.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
15	PDB:7r5jP0	0.207	0.480	1.489E-4	655	0.045	0.125	7r5jP0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:7vciH	0.188	0.361	3.377E-4	798	0.054	0.123	7vciH.pdb.gz
17	PDB:7f60D	0.028	0.927	7.028E-4	52	0.029	1.000	7f60D.pdb.gz	Structural basis for Sarbecovirus ORF6 mediated blockage of nucleocytoplasmic transport
18	PDB:7fikP	0.094	0.207	2.793E-3	593	0.039	0.120	7fikP.pdb.gz
19	PDB:7r5jA0	0.173	0.311	6.336E-3	818	0.045	0.100	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7f90D	0.025	0.942	7.861E-3	46	0.025	0.978	7f90D.pdb.gz	Structural basis for Sarbecovirus ORF6 mediated blockage of nucleocytoplasmic transport

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IAQ8	0.0	1976	1807	0.625	0.629	A0A0R4IAQ8_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=2
2	E7F981	0.0	1982	1814	0.626	0.627	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
3	P49793	0.0	3274	1816	0.914	0.915	NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus OX=10116 GN=Nup98 PE=1 SV=2
4	P52948	0.0	3746	1817	1.000	1.000	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
5	Q6DCP4	0.0	693	647	0.245	0.689	Q6DCP4_XENLA Nup98 protein (Fragment) OS=Xenopus laevis OX=8355 GN=Nup98 PE=2 SV=1
6	Q6PFD9	0.0	3286	1816	0.916	0.916	NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus OX=10090 GN=Nup98 PE=1 SV=2
7	Q9VCH5	0.0	738	1960	0.357	0.331	NUP98_DROME Nuclear pore complex protein Nup98-Nup96 OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=1 SV=3
8	Q867M7	9.34e-97	338	932	0.162	0.317	Q867M7_DROME Nucleoporin 98-96 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
9	Q86G43	1.01e-96	337	932	0.162	0.317	Q86G43_DROME Nucleoporin 98-96 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
10	Q868A8	1.60e-96	337	932	0.162	0.315	Q868A8_DROME Nucleoporin 98-96 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
11	Q867W7	2.72e-96	336	932	0.162	0.315	Q867W7_DROME Nucleoporin 98-96 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
12	Q867M2	4.32e-96	335	932	0.161	0.314	Q867M2_DROME Nucleoporin 98-96 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
13	Q867H5	1.40e-95	334	932	0.161	0.313	Q867H5_DROME Nucleoporin 98-96 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
14	A1YK38	8.63e-58	208	413	0.078	0.344	A1YK38_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
15	A1YK24	1.63e-57	207	413	0.078	0.344	A1YK24_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
16	A1YK25	3.37e-57	206	413	0.079	0.346	A1YK25_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
17	A1YK27	7.45e-57	206	413	0.078	0.341	A1YK27_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
18	A1YK35	1.88e-56	204	413	0.076	0.337	A1YK35_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
19	A1YK36	2.57e-56	204	413	0.047	0.206	A1YK36_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1
20	A1YK33	6.54e-56	203	413	0.077	0.339	A1YK33_DROME Nup98 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.1e+02	14.5	Anaphase-promoting complex, cyclosome, subunit 3
2	PF04096 Nucleoporin2	4.9e-42	155.0	Nucleoporin autopeptidase
3	PF13634 Nucleoporin_FG	1.3	21.3	Nucleoporin FG repeat region
4	PF12110 Nup96	3.7e-95	330.0	Nuclear protein 96

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229179	0.999	Nuclear pore complex protein Nup107
2	9606.ENSP00000231498	0.999	Nuclear pore complex protein Nup155
3	9606.ENSP00000245544	0.999	Nuclear pore complex protein Nup85
4	9606.ENSP00000261396	0.999	Nuclear pore complex protein Nup133
5	9606.ENSP00000342262	0.999	Nucleoporin Nup43
6	9606.ENSP00000367721	0.999	Nuclear pore complex protein Nup160
7	9606.ENSP00000373312	0.999	Protein SEC13 homolog
8	9606.ENSP00000379182	0.999	mRNA export factor
9	9606.ENSP00000382779	0.999	Nucleoporin SEH1
10	9606.ENSP00000384863	0.998	Exportin-1
11	9606.ENSP00000444029	0.998	Nuclear pore complex protein Nup153
12	9606.ENSP00000458954	0.998	Nuclear pore complex protein Nup88
13	9606.ENSP00000264883	0.997	Nucleoporin p54
14	9606.ENSP00000285968	0.997	Nuclear pore complex protein Nup205
15	9606.ENSP00000310668	0.997	Nuclear pore complex protein Nup93
16	9606.ENSP00000436679	0.997	Nuclear RNA export factor 1
17	9606.ENSP00000448054	0.997	Nucleoporin Nup37
18	9606.ENSP00000290158	0.996	Importin subunit beta-1
19	9606.ENSP00000356448	0.995	Nucleoprotein TPR
20	9606.ENSP00000308622	0.994	Nucleoporin GLE1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.995	nucleic acid binding
GO:0003723	0.981	RNA binding
GO:0017056	0.972	structural constituent of nuclear pore
GO:1990841	0.850	promoter-specific chromatin binding
GO:0140110	0.836	transcription regulator activity
GO:0003712	0.821	transcription coregulator activity
GO:0003713	0.814	transcription coactivator activity
GO:0003729	0.758	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0046907	0.987	intracellular transport
GO:0006913	0.982	nucleocytoplasmic transport
GO:0050794	0.899	regulation of cellular process
GO:0051170	0.846	import into nucleus
GO:0034504	0.845	protein localization to nucleus
GO:0045184	0.771	establishment of protein localization
GO:0019222	0.768	regulation of metabolic process
GO:0015031	0.762	protein transport
GO:0060255	0.742	regulation of macromolecule metabolic process
GO:0048518	0.715	positive regulation of biological process
GO:0006886	0.711	intracellular protein transport
GO:0071840	0.704	cellular component organization or biogenesis
GO:0051171	0.701	regulation of nitrogen compound metabolic process
GO:0080090	0.696	regulation of primary metabolic process
GO:0031323	0.696	regulation of cellular metabolic process
GO:0048522	0.680	positive regulation of cellular process
GO:0016043	0.667	cellular component organization
GO:0010468	0.657	regulation of gene expression
GO:0019219	0.645	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.629	positive regulation of metabolic process
GO:0051252	0.629	regulation of RNA metabolic process
GO:0010604	0.608	positive regulation of macromolecule metabolic process
GO:0051173	0.469	positive regulation of nitrogen compound metabolic process
GO:0031325	0.467	positive regulation of cellular metabolic process
GO:0006606	0.392	protein import into nucleus
GO:0045935	0.380	positive regulation of nucleobase-containing compound metabolic process
GO:0022607	0.349	cellular component assembly
GO:0071704	0.345	organic substance metabolic process
GO:0006996	0.335	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	0.999	nuclear protein-containing complex
GO:0005635	0.999	nuclear envelope
GO:0005654	0.998	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0031965	0.990	nuclear membrane
GO:0005643	0.990	nuclear pore
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.983	cytosol
GO:0034399	0.922	nuclear periphery
GO:0016234	0.903	inclusion body
GO:0042405	0.881	nuclear inclusion body
GO:0044615	0.878	nuclear pore nuclear basket
GO:0005694	0.834	chromosome
GO:0098687	0.432	chromosomal region
GO:0000793	0.316	condensed chromosome
GO:0000779	0.313	condensed chromosome, centromeric region
GO:1990904	0.311	ribonucleoprotein complex
GO:0000776	0.303	kinetochore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]