StarFunc result for job id P52951

User Input

>input (348 residues)
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8AXK9	0.274	0.279	2.643E-34	342	0.724	0.737	Q8AXK9.pdb.gz
2	AFDB:P82976	0.323	0.279	9.982E-21	418	0.506	0.421	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
3	AFDB:P07548	0.171	0.102	6.637E-8	586	0.270	0.160	P07548.pdb.gz	DFD_DROME Homeotic protein deformed OS=Drosophila melanogaster OX=7227 GN=Dfd PE=1 SV=2
4	AFDB:Q9GZZ0	0.171	0.181	6.017E-7	328	0.241	0.256	Q9GZZ0.pdb.gz	HXD1_HUMAN Homeobox protein Hox-D1 OS=Homo sapiens OX=9606 GN=HOXD1 PE=2 SV=1
5	AFDB:P31275	0.198	0.242	8.983E-7	282	0.207	0.255	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
6	AFDB:P31276	0.190	0.200	2.002E-6	330	0.216	0.227	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
7	AFDB:P09085	0.173	0.144	2.796E-6	427	0.207	0.169	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
8	AFDB:P79724	0.196	0.234	2.796E-6	289	0.161	0.194	P79724.pdb.gz	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
9	AFDB:Q9YH70	0.195	0.203	4.772E-6	334	0.201	0.210	Q9YH70.pdb.gz	Q9YH70_XENLA VENT homeobox 2, gene 2 S homeolog OS=Xenopus laevis OX=8355 GN=ventx2.2.S PE=4 SV=1
10	AFDB:P10105	0.177	0.100	5.831E-6	635	0.250	0.137	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
11	PDB:4egcA	0.146	0.094	1.197E-2	539	0.043	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.143	0.612	1.911E-2	73	0.060	0.288	2hi3A.pdb.gz
13	PDB:7fbyA	0.111	0.223	2.955E-1	153	0.034	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:4pcqB	0.107	0.222	3.160E-1	149	0.046	0.107	4pcqB.pdb.gz
15	PDB:5aj0BZ	0.121	0.416	6.588E-1	86	0.040	0.163	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:2rvqD	0.085	0.174	8.606E-1	129	0.055	0.147	2rvqD.pdb.gz
17	PDB:4v8mAU	0.114	0.400	1.052	85	0.049	0.200	4v8mAU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:7pj1B	0.086	0.149	1.202	122	0.055	0.156	7pj1B.pdb.gz
19	PDB:2cg4A	0.112	0.231	1.285	149	0.020	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:5z56L	0.129	0.131	1.469	342	0.034	0.035	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48031	0.0	693	348	0.983	0.983	GBX2_MOUSE Homeobox protein GBX-2 OS=Mus musculus OX=10090 GN=Gbx2 PE=2 SV=1
2	P52951	0.0	707	348	1.000	1.000	GBX2_HUMAN Homeobox protein GBX-2 OS=Homo sapiens OX=9606 GN=GBX2 PE=2 SV=3
3	Q8QGU1	1.27e-153	437	342	0.727	0.740	Q8QGU1_DANRE Gastrulation brain homeo box 2 OS=Danio rerio OX=7955 GN=fd07f12 PE=2 SV=1
4	Q90ZB2	1.71e-96	291	316	0.506	0.557	Q90ZB2_DANRE Gastrulation brain homeobox 1 OS=Danio rerio OX=7955 GN=wu:fj77a06 PE=2 SV=1
5	P82976	3.52e-77	244	418	0.500	0.416	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
6	Q4V5A3	1.15e-41	153	485	0.216	0.155	UNPG_DROME Homeobox protein unplugged OS=Drosophila melanogaster OX=7227 GN=unpg PE=2 SV=1
7	Q9VSC2	1.81e-20	94.4	525	0.126	0.084	Q9VSC2_DROME Extra-extra OS=Drosophila melanogaster OX=7227 GN=exex PE=2 SV=1
8	P06798	5.96e-20	90.5	285	0.115	0.140	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
9	G3UXB3	1.15e-19	91.7	440	0.126	0.100	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
10	P07548	3.54e-19	90.9	586	0.124	0.073	DFD_DROME Homeotic protein deformed OS=Drosophila melanogaster OX=7227 GN=Dfd PE=1 SV=2
11	H0YHX3	4.78e-19	84.3	140	0.112	0.279	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
12	P10284	5.75e-19	87.0	250	0.109	0.152	HXB4_MOUSE Homeobox protein Hox-B4 OS=Mus musculus OX=10090 GN=Hoxb4 PE=2 SV=1
13	P50219	6.26e-19	89.4	401	0.118	0.102	MNX1_HUMAN Motor neuron and pancreas homeobox protein 1 OS=Homo sapiens OX=9606 GN=MNX1 PE=1 SV=3
14	Q6SYZ1	8.09e-19	87.8	311	0.118	0.132	Q6SYZ1_DANRE Homeodomain protein Hb9 OS=Danio rerio OX=7955 GN=hb9 PE=2 SV=1
15	Q9QZW9	8.35e-19	89.0	404	0.118	0.101	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
16	Q00056	8.46e-19	87.8	320	0.112	0.122	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
17	M0R6D8	9.12e-19	89.0	403	0.135	0.117	MNX1_RAT Motor neuron and pancreas homeobox 1 OS=Rattus norvegicus OX=10116 GN=Mnx1 PE=3 SV=2
18	Q86TF7	9.84e-19	86.7	264	0.106	0.140	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1
19	F1RCJ6	9.97e-19	87.8	328	0.132	0.140	F1RCJ6_DANRE Motor neuron and pancreas homeobox 2b OS=Danio rerio OX=7955 GN=hlxb9lb PE=4 SV=1
20	Q08624	1.00e-18	86.7	264	0.106	0.140	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	5.2e-20	82.3	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302251

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321797	0.822	Fibroblast growth factor 8
2	9606.ENSP00000282928	0.793	Zinc finger protein ZIC 1
3	9606.ENSP00000359319	0.781	Paired box protein Pax-2
4	9606.ENSP00000293549	0.724	Proto-oncogene Wnt-1
5	9606.ENSP00000331608	0.634	Iroquois-class homeodomain protein IRX-3
6	9606.ENSP00000339004	0.623	Forkhead box protein G1
7	9606.ENSP00000263707	0.616	Transcription factor CP2-like protein 1
8	9606.ENSP00000297261	0.615	Sonic hedgehog protein
9	9606.ENSP00000307634	0.604	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1
10	9606.ENSP00000362717	0.596	LIM/homeobox protein Lhx2
11	9606.ENSP00000360157	0.595	Forkhead box protein D3
12	9606.ENSP00000340226	0.590	LIM homeobox transcription factor 1-alpha
13	9606.ENSP00000323588	0.589	Transcription factor SOX-2
14	9606.ENSP00000347684	0.587	LIM homeobox transcription factor 1-beta
15	9606.ENSP00000260653	0.584	Homeobox protein SIX3
16	9606.ENSP00000290552	0.575	Iroquois-class homeodomain protein IRX-6
17	9606.ENSP00000422488	0.570	Steroid hormone receptor ERR2
18	9606.ENSP00000311697	0.562	Fibroblast growth factor 5
19	9606.ENSP00000247182	0.559	Homeobox protein SIX1
20	9606.ENSP00000259915	0.546	POU domain, class 5, transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.976	protein binding
GO:0000976	0.707	transcription cis-regulatory region binding
GO:0000977	0.581	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.997	multicellular organism development
GO:0048731	0.988	system development
GO:0009987	0.969	cellular process
GO:0050789	0.917	regulation of biological process
GO:0048513	0.913	animal organ development
GO:0050794	0.905	regulation of cellular process
GO:0007399	0.904	nervous system development
GO:0030154	0.831	cell differentiation
GO:0019222	0.792	regulation of metabolic process
GO:0060255	0.780	regulation of macromolecule metabolic process
GO:0080090	0.778	regulation of primary metabolic process
GO:0051171	0.778	regulation of nitrogen compound metabolic process
GO:0031323	0.778	regulation of cellular metabolic process
GO:0010468	0.742	regulation of gene expression
GO:0007417	0.638	central nervous system development
GO:0019219	0.633	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.632	regulation of biosynthetic process
GO:0051252	0.617	regulation of RNA metabolic process
GO:0048518	0.578	positive regulation of biological process
GO:0031326	0.576	regulation of cellular biosynthetic process
GO:0006355	0.571	regulation of DNA-templated transcription
GO:0048522	0.559	positive regulation of cellular process
GO:0009893	0.441	positive regulation of metabolic process
GO:0010604	0.423	positive regulation of macromolecule metabolic process
GO:0050896	0.422	response to stimulus
GO:0009653	0.406	anatomical structure morphogenesis
GO:0048519	0.404	negative regulation of biological process
GO:0006357	0.391	regulation of transcription by RNA polymerase II
GO:0051173	0.386	positive regulation of nitrogen compound metabolic process
GO:0048523	0.347	negative regulation of cellular process
GO:0009891	0.329	positive regulation of biosynthetic process
GO:0045935	0.325	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.322	positive regulation of cellular biosynthetic process
GO:0051254	0.318	positive regulation of RNA metabolic process
GO:0010557	0.316	positive regulation of macromolecule biosynthetic process
GO:0045893	0.307	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.424	nuclear lumen
GO:0005654	0.393	nucleoplasm
GO:0005737	0.338	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]