StarFunc result for job id P52952

User Input

>input (324 residues)
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPE
AAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAV
ELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTST
QVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPA
YGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDL
NAVQSPGIPQSNSGVSTLHGIRAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52952	0.999	0.999	1.539E-47	324	1.000	1.000	P52952.pdb.gz	NKX25_HUMAN Homeobox protein Nkx-2.5 OS=Homo sapiens OX=9606 GN=NKX2-5 PE=1 SV=1
2	AFDB:O35767	0.305	0.309	3.593E-39	318	0.858	0.874	O35767.pdb.gz	NKX25_RAT Homeobox protein Nkx-2.5 OS=Rattus norvegicus OX=10116 GN=Nkx2-5 PE=2 SV=1
3	AFDB:F1NC42	0.306	0.331	8.494E-28	294	0.648	0.714	F1NC42.pdb.gz
4	AFDB:A0A2R8RJR5	0.254	0.261	6.204E-22	314	0.522	0.538	A0A2R8RJR5.pdb.gz
5	AFDB:A6NCS4	0.318	0.338	3.728E-14	301	0.457	0.492	A6NCS4.pdb.gz	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
6	AFDB:Q7PL95	0.214	0.150	2.854E-13	468	0.312	0.216	Q7PL95.pdb.gz	Q7PL95_DROME Scarecrow, isoform A OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=1
7	AFDB:O13005	0.239	0.392	2.050E-11	193	0.321	0.539	O13005.pdb.gz	O13005_CHICK Nkx2-8 protein OS=Gallus gallus OX=9031 GN=Nkx2-8 PE=2 SV=1
8	AFDB:B3DH68	0.204	0.192	6.096E-10	346	0.321	0.301	B3DH68.pdb.gz
9	AFDB:O15522	0.200	0.267	4.994E-9	239	0.299	0.406	O15522.pdb.gz	NKX28_HUMAN Homeobox protein Nkx-2.8 OS=Homo sapiens OX=9606 GN=NKX2-8 PE=2 SV=2
10	AFDB:P23441	0.237	0.211	7.011E-9	372	0.389	0.339	P23441.pdb.gz	NKX21_RAT Homeobox protein Nkx-2.1 OS=Rattus norvegicus OX=10116 GN=Nkx2-1 PE=1 SV=1
11	PDB:4egcA	0.147	0.089	1.552E-2	539	0.049	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.152	0.606	6.935E-1	73	0.049	0.219	2hi3A.pdb.gz
13	PDB:5jaaA	0.090	0.226	7.422E-1	102	0.059	0.186	5jaaA.pdb.gz
14	PDB:5aj0BZ	0.129	0.413	7.943E-1	86	0.037	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5nr5A	0.113	0.295	1.277	113	0.056	0.159	5nr5A.pdb.gz
16	PDB:6lthQ	0.111	0.234	1.367	105	0.068	0.210	6lthQ.pdb.gz	Structure of nucleosome-bound human BAF complex.
17	PDB:7awtE	0.102	0.200	1.367	156	0.025	0.051	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
18	PDB:4v8mAU	0.133	0.438	1.463	85	0.031	0.118	4v8mAU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:7b93E	0.087	0.123	2.352	215	0.028	0.042	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:7fbyA	0.117	0.227	2.883	153	0.022	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52952	0.0	645	324	1.000	1.000	NKX25_HUMAN Homeobox protein Nkx-2.5 OS=Homo sapiens OX=9606 GN=NKX2-5 PE=1 SV=1
2	P42582	8.12e-177	493	318	0.867	0.884	NKX25_MOUSE Homeobox protein Nkx-2.5 OS=Mus musculus OX=10090 GN=Nkx2-5 PE=1 SV=1
3	O35767	1.48e-175	490	318	0.849	0.865	NKX25_RAT Homeobox protein Nkx-2.5 OS=Rattus norvegicus OX=10116 GN=Nkx2-5 PE=2 SV=1
4	Q90788	1.36e-120	350	294	0.623	0.687	NKX25_CHICK Homeobox protein Nkx-2.5 OS=Gallus gallus OX=9031 GN=NKX-2.5 PE=2 SV=1
5	Q98872	5.41e-110	324	314	0.543	0.561	Q98872_DANRE Homeobox protein Nkx-2.5 OS=Danio rerio OX=7955 GN=nk2.5 PE=2 SV=1
6	P97334	1.09e-64	210	362	0.525	0.470	NKX23_MOUSE Homeobox protein Nkx-2.3 OS=Mus musculus OX=10090 GN=Nkx2-3 PE=2 SV=2
7	Q8TAU0	4.33e-64	208	364	0.512	0.456	NKX23_HUMAN Homeobox protein Nkx-2.3 OS=Homo sapiens OX=9606 GN=NKX2-3 PE=2 SV=2
8	A6NCS4	4.33e-63	204	301	0.457	0.492	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
9	O13005	4.76e-54	177	193	0.262	0.440	O13005_CHICK Nkx2-8 protein OS=Gallus gallus OX=9031 GN=Nkx2-8 PE=2 SV=1
10	Q98873	2.15e-53	178	269	0.358	0.431	Q98873_DANRE Homeodomain protein Nkx2.7 OS=Danio rerio OX=7955 GN=nk2.7 PE=2 SV=1
11	P43688	6.25e-45	156	289	0.302	0.339	NKX26_MOUSE Homeobox protein Nkx-2.6 OS=Mus musculus OX=10090 GN=Nkx2-6 PE=2 SV=2
12	A8Y527	1.03e-39	143	307	0.201	0.212	A8Y527_DROME Scarecrow, isoform F OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=2
13	Q90481	7.56e-39	140	269	0.309	0.372	NX22A_DANRE Homeobox protein Nkx-2.2a OS=Danio rerio OX=7955 GN=nkx2.2a PE=2 SV=1
14	Q7PL95	7.80e-39	144	468	0.235	0.162	Q7PL95_DROME Scarecrow, isoform A OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=1
15	Q9NCG1	1.19e-38	142	380	0.201	0.171	Q9NCG1_DROME Homeobox protein Scarecrow (Fragment) OS=Drosophila melanogaster OX=7227 GN=scro PE=2 SV=1
16	D3ZDQ2	2.67e-37	136	273	0.201	0.238	D3ZDQ2_RAT NK2 homeobox 2 OS=Rattus norvegicus OX=10116 GN=Nkx2-2 PE=4 SV=1
17	P42586	2.82e-37	136	273	0.201	0.238	NKX22_MOUSE Homeobox protein Nkx-2.2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=2
18	O95096	3.00e-37	136	273	0.201	0.238	NKX22_HUMAN Homeobox protein Nkx-2.2 OS=Homo sapiens OX=9606 GN=NKX2-2 PE=2 SV=1
19	B3DG22	1.68e-36	135	336	0.318	0.307	B3DG22_DANRE Homeobox protein Nkx-2.4 isoform 2 OS=Danio rerio OX=7955 GN=LOC100148014 PE=2 SV=1
20	Q98TX4	1.71e-36	136	346	0.327	0.306	Q98TX4_DANRE Homeobox protein Nkx-2.1 OS=Danio rerio OX=7955 GN=nk2.1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	5.4e+02	11.9	Homeobox KN domain
2	PF00046 Homeodomain	1.1e-16	71.7	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327758

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309913	0.999	T-box transcription factor TBX5
2	9606.ENSP00000334458	0.999	Transcription factor GATA-4
3	9606.ENSP00000340874	0.996	Myocyte-specific enhancer factor 2C
4	9606.ENSP00000352565	0.994	Heart- and neural crest derivatives-expressed protein 2
5	9606.ENSP00000265354	0.989	Serum response factor
6	9606.ENSP00000366534	0.985	Forkhead box protein H1
7	9606.ENSP00000386170	0.985	T-box transcription factor TBX20
8	9606.ENSP00000341551	0.980	Mothers against decapentaplegic homolog 4
9	9606.ENSP00000245451	0.979	Bone morphogenetic protein 4
10	9606.ENSP00000228841	0.978	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
11	9606.ENSP00000295379	0.973	Bone morphogenetic protein 10
12	9606.ENSP00000231121	0.972	Heart- and neural crest derivatives-expressed protein 1
13	9606.ENSP00000365663	0.970	Natriuretic peptides A
14	9606.ENSP00000368104	0.969	Bone morphogenetic protein 2
15	9606.ENSP00000262160	0.939	Mothers against decapentaplegic homolog 2
16	9606.ENSP00000389377	0.937	Nuclear factor of activated T-cells, cytoplasmic 1
17	9606.ENSP00000328181	0.936	Noggin
18	9606.ENSP00000361107	0.936	Bone morphogenetic protein receptor type-1A
19	9606.ENSP00000288840	0.935	Mothers against decapentaplegic homolog 6
20	9606.ENSP00000204604	0.932	Chordin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.993	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.861	transcription factor binding
GO:0140297	0.846	DNA-binding transcription factor binding
GO:0061629	0.813	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003682	0.755	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0032502	0.995	developmental process
GO:0050794	0.994	regulation of cellular process
GO:0007275	0.989	multicellular organism development
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0009987	0.981	cellular process
GO:0009653	0.977	anatomical structure morphogenesis
GO:0010468	0.977	regulation of gene expression
GO:0009888	0.972	tissue development
GO:0019219	0.971	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.959	regulation of DNA-templated transcription
GO:0048731	0.949	system development
GO:0048513	0.929	animal organ development
GO:0048518	0.885	positive regulation of biological process
GO:0006357	0.877	regulation of transcription by RNA polymerase II
GO:0048522	0.871	positive regulation of cellular process
GO:0007507	0.846	heart development
GO:0030154	0.830	cell differentiation
GO:0061061	0.828	muscle structure development
GO:0009887	0.818	animal organ morphogenesis
GO:0048519	0.803	negative regulation of biological process
GO:0050896	0.790	response to stimulus
GO:0048523	0.777	negative regulation of cellular process
GO:0050793	0.773	regulation of developmental process
GO:0048738	0.767	cardiac muscle tissue development
GO:0009893	0.741	positive regulation of metabolic process
GO:0045892	0.719	negative regulation of DNA-templated transcription
GO:0051173	0.697	positive regulation of nitrogen compound metabolic process
GO:0003007	0.693	heart morphogenesis
GO:0031325	0.692	positive regulation of cellular metabolic process
GO:0010604	0.689	positive regulation of macromolecule metabolic process
GO:0003205	0.676	cardiac chamber development
GO:0042981	0.643	regulation of apoptotic process
GO:0060548	0.613	negative regulation of cell death
GO:0003206	0.607	cardiac chamber morphogenesis
GO:0043066	0.573	negative regulation of apoptotic process
GO:0045595	0.569	regulation of cell differentiation
GO:0045935	0.507	positive regulation of nucleobase-containing compound metabolic process
GO:0045944	0.500	positive regulation of transcription by RNA polymerase II
GO:0000122	0.485	negative regulation of transcription by RNA polymerase II
GO:0051239	0.469	regulation of multicellular organismal process
GO:0003151	0.421	outflow tract morphogenesis
GO:0010660	0.412	regulation of muscle cell apoptotic process
GO:0003231	0.398	cardiac ventricle development
GO:0051716	0.397	cellular response to stimulus
GO:0010664	0.390	negative regulation of striated muscle cell apoptotic process
GO:0010665	0.365	regulation of cardiac muscle cell apoptotic process
GO:0051094	0.351	positive regulation of developmental process
GO:0003208	0.329	cardiac ventricle morphogenesis
GO:0035051	0.316	cardiocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.992	protein-containing complex
GO:0070013	0.972	intracellular organelle lumen
GO:0031981	0.963	nuclear lumen
GO:0005654	0.954	nucleoplasm
GO:0005737	0.639	cytoplasm
GO:0005667	0.544	transcription regulator complex
GO:0140513	0.348	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]