StarFunc result for job id P52961

User Input

>input (327 residues)
MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAA
LPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRG
VHGLRFRPAGPRATVRLGGFASASLKHVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYIKDKKCKSGPCHLDNSAMGQS
PLSAVWSLLLLLWFLVVRAFPDGPGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52961	1.000	1.000	5.544E-67	327	1.000	1.000	P52961.pdb.gz	NAR1_HUMAN GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 OS=Homo sapiens OX=9606 GN=ART1 PE=2 SV=2
2	AFDB:Q60935	0.817	0.822	2.791E-50	325	0.768	0.772	Q60935.pdb.gz	NAR1_MOUSE GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 OS=Mus musculus OX=10090 GN=Art1 PE=1 SV=1
3	AFDB:P55807	0.699	0.732	1.324E-33	312	0.388	0.407	P55807.pdb.gz	NRT2_CHICK NAD(P)(+)--arginine ADP-ribosyltransferase 2 OS=Gallus gallus OX=9031 PE=2 SV=1
4	AFDB:P55806	0.694	0.726	3.861E-32	312	0.382	0.401	P55806.pdb.gz	NRT1_CHICK NAD(P)(+)--arginine ADP-ribosyltransferase 1 OS=Gallus gallus OX=9031 PE=1 SV=1
5	AFDB:A0A024RCD1	0.707	0.789	1.015E-27	292	0.300	0.336	A0A024RCD1.pdb.gz
6	AFDB:O35975	0.649	0.730	1.223E-25	289	0.318	0.360	O35975.pdb.gz	NAR2B_MOUSE T-cell ecto-ADP-ribosyltransferase 2 OS=Mus musculus OX=10090 GN=Art2b PE=1 SV=2
7	AFDB:P17982	0.621	0.735	1.550E-25	275	0.327	0.389	P17982.pdb.gz	NAR2A_RAT T-cell ecto-ADP-ribosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Art2a PE=1 SV=1
8	AFDB:P17981	0.635	0.720	2.801E-25	287	0.318	0.362	P17981.pdb.gz	NAR2A_MOUSE T-cell ecto-ADP-ribosyltransferase 1 OS=Mus musculus OX=10090 GN=Art2a PE=1 SV=2
9	AFDB:Q93070	0.644	0.669	1.176E-21	314	0.291	0.303	Q93070.pdb.gz	NAR4_HUMAN Ecto-ADP-ribosyltransferase 4 OS=Homo sapiens OX=9606 GN=ART4 PE=2 SV=2
10	AFDB:Q13508	0.621	0.526	3.877E-19	389	0.254	0.213	Q13508.pdb.gz	NAR3_HUMAN Ecto-ADP-ribosyltransferase 3 OS=Homo sapiens OX=9606 GN=ART3 PE=1 SV=2
11	PDB:3u0jB	0.412	0.549	4.523E-9	236	0.150	0.208	3u0jB.pdb.gz
12	PDB:1pwwA	0.250	0.125	5.268E-2	726	0.037	0.017	1pwwA.pdb.gz	The structural basis for substrate and inhibitor selectivity of the anthrax lethal factor.
13	PDB:1s5bA	0.150	0.221	3.712E-1	208	0.061	0.096	1s5bA.pdb.gz
14	PDB:3ayhB	0.095	0.149	6.707E-1	183	0.037	0.066	3ayhB.pdb.gz
15	PDB:4jyzA	0.085	0.060	9.016E-1	542	0.049	0.030	4jyzA.pdb.gz	Structural and Mechanistic Basis for Enhanced Translational Efficiency by 2-Thiouridine at the tRNA Anticodon Wobble Position.
16	PDB:2c35B	0.110	0.183	9.566E-1	171	0.031	0.058	2c35B.pdb.gz
17	PDB:3oaiA	0.072	0.053	9.566E-1	488	0.073	0.049	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
18	PDB:6h0gB	0.081	0.071	9.566E-1	401	0.021	0.017	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
19	PDB:1s5eA	0.116	0.158	1.077	232	0.049	0.069	1s5eA.pdb.gz	Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
20	PDB:7uy7B	0.101	0.110	1.077	291	0.024	0.027	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52961	0.0	674	327	1.000	1.000	NAR1_HUMAN GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 OS=Homo sapiens OX=9606 GN=ART1 PE=2 SV=2
2	Q60935	9.45e-169	473	325	0.731	0.735	NAR1_MOUSE GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 OS=Mus musculus OX=10090 GN=Art1 PE=1 SV=1
3	P55807	7.40e-72	227	312	0.404	0.423	NRT2_CHICK NAD(P)(+)--arginine ADP-ribosyltransferase 2 OS=Gallus gallus OX=9031 PE=2 SV=1
4	P55806	1.29e-68	218	312	0.398	0.417	NRT1_CHICK NAD(P)(+)--arginine ADP-ribosyltransferase 1 OS=Gallus gallus OX=9031 PE=1 SV=1
5	Q93070	5.58e-41	147	314	0.291	0.303	NAR4_HUMAN Ecto-ADP-ribosyltransferase 4 OS=Homo sapiens OX=9606 GN=ART4 PE=2 SV=2
6	P20974	4.62e-39	141	275	0.303	0.360	NAR2B_RAT T-cell ecto-ADP-ribosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Art2b PE=1 SV=2
7	P17982	5.36e-39	140	275	0.291	0.345	NAR2A_RAT T-cell ecto-ADP-ribosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Art2a PE=1 SV=1
8	P17981	6.09e-36	133	287	0.275	0.314	NAR2A_MOUSE T-cell ecto-ADP-ribosyltransferase 1 OS=Mus musculus OX=10090 GN=Art2a PE=1 SV=2
9	O35975	2.33e-34	129	289	0.284	0.322	NAR2B_MOUSE T-cell ecto-ADP-ribosyltransferase 2 OS=Mus musculus OX=10090 GN=Art2b PE=1 SV=2
10	Q13508	3.31e-26	109	389	0.272	0.229	NAR3_HUMAN Ecto-ADP-ribosyltransferase 3 OS=Homo sapiens OX=9606 GN=ART3 PE=1 SV=2
11	Q88A91	0.64	33.9	264	0.052	0.064	Q88A91_PSESM Type III effector HopU1 OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=hopU1 PE=1 SV=1
12	A0A1P8AUY4	4.3	32.0	5400	0.058	0.004	MDN1_ARATH Midasin OS=Arabidopsis thaliana OX=3702 GN=MDN1 PE=1 SV=1
13	O49498	9.5	30.8	1044	0.046	0.014	DML3_ARATH DEMETER-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=DML3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01129 ART	3.9e-94	325.6	NAD:arginine ADP-ribosyltransferase
2	PF15628 RRM_DME	3.3e+02	12.9	RRM in Demeter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265016	0.756	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
2	9606.ENSP00000285402	0.745	Outer dense fiber protein 1
3	9606.ENSP00000402000	0.722	Septin-4
4	9606.ENSP00000255681	0.705	O-acetyl-ADP-ribose deacetylase MACROD1
5	9606.ENSP00000355759	0.663	Poly [ADP-ribose] polymerase 1
6	9606.ENSP00000340608	0.653	Serine/threonine-protein kinase Sgk2
7	9606.ENSP00000384408	0.645	Poly(ADP-ribose) glycohydrolase
8	9606.ENSP00000226279	0.610	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
9	9606.ENSP00000383333	0.606	MORC family CW-type zinc finger protein 3
10	9606.ENSP00000347821	0.554	MORC family CW-type zinc finger 4
11	9606.ENSP00000330696	0.545	P2X purinoceptor 7
12	9606.ENSP00000328359	0.540	Neutrophil defensin 3
13	9606.ENSP00000297435	0.538	Neutrophil defensin 4
14	9606.ENSP00000420200	0.527	[Protein ADP-ribosylarginine] hydrolase
15	9606.ENSP00000234296	0.515	Origin recognition complex subunit 2
16	9606.ENSP00000302599	0.514	Alpha-(1,3)-fucosyltransferase 9
17	9606.ENSP00000362273	0.504	Poly(ADP-ribose) glycohydrolase ARH3
18	9606.ENSP00000281631	0.501	poly(ADP-ribose) polymerase family member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016763	1.000	pentosyltransferase activity
GO:0140096	0.998	catalytic activity, acting on a protein
GO:1990404	0.994	NAD+-protein ADP-ribosyltransferase activity
GO:0106274	0.872	NAD+-protein-arginine ADP-ribosyltransferase activity
GO:0003950	0.712	NAD+ ADP-ribosyltransferase activity
GO:0005488	0.663	binding
GO:0005515	0.560	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0042221	0.939	response to chemical
GO:0046677	0.876	response to antibiotic
GO:0065007	0.633	biological regulation
GO:0009987	0.602	cellular process
GO:0050789	0.448	regulation of biological process
GO:0050794	0.400	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0016020	0.993	membrane
GO:0071944	0.956	cell periphery
GO:0005886	0.950	plasma membrane
GO:0070013	0.550	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.-	1.000	Pentosyltransferases.
RHEA:19149	0.872	L-arginyl-[protein] + NAD(+) = H(+) + N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide
EC:2.4.2.31	0.872	NAD(+)--protein-arginine ADP-ribosyltransferase.
EC:2.4.2.30	0.712	NAD(+) ADP-ribosyltransferase.

[back to server]