StarFunc result for job id P53004

User Input

>input (296 residues)
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLE
DALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKV
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJF4	1.000	1.000	1.107E-63	296	1.000	1.000	A0A140VJF4.pdb.gz	A0A140VJF4_HUMAN Biliverdin reductase A OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q9CY64	0.985	0.989	1.526E-57	295	0.824	0.827	Q9CY64.pdb.gz	BIEA_MOUSE Biliverdin reductase A OS=Mus musculus OX=10090 GN=Blvra PE=1 SV=1
3	AFDB:P46844	0.988	0.991	1.231E-56	295	0.831	0.834	P46844.pdb.gz	BIEA_RAT Biliverdin reductase A OS=Rattus norvegicus OX=10116 GN=Blvra PE=1 SV=1
4	PDB:2h63D	0.950	0.986	6.807E-54	285	0.953	0.989	2h63D.pdb.gz	Crystal Structure of Human Biliverdin Reductase A
5	PDB:1lc3A	0.960	0.973	6.335E-52	292	0.811	0.822	1lc3A.pdb.gz	Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
6	AFDB:Q9KWL3	0.757	0.716	7.867E-18	315	0.172	0.162	Q9KWL3.pdb.gz	LIGC_SPHSK 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase OS=Sphingobium sp. (strain NBRC 103272 / SYK-6) OX=627192 GN=ligC PE=1 SV=1
7	AFDB:O42896	0.748	0.616	2.357E-16	368	0.220	0.177	O42896.pdb.gz	YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
8	AFDB:P46853	0.668	0.584	6.897E-16	345	0.189	0.162	P46853.pdb.gz	YHHX_ECOLI Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1
9	AFDB:O13991	0.721	0.594	7.321E-16	369	0.206	0.165	O13991.pdb.gz	YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
10	PDB:6jnjB	0.779	0.753	1.171E-15	307	0.162	0.156	6jnjB.pdb.gz
11	PDB:6o15A	0.752	0.637	1.401E-15	355	0.176	0.146	6o15A.pdb.gz	On the structure and function of Escherichia coli YjhC: An oxidoreductase involved in bacterial sialic acid metabolism.
12	PDB:3f4lA	0.679	0.595	1.578E-15	344	0.193	0.166	3f4lA.pdb.gz
13	AFDB:P40332	0.763	0.671	2.562E-15	342	0.162	0.140	P40332.pdb.gz	IOLX_BACSU scyllo-inositol 2-dehydrogenase (NAD(+)) OS=Bacillus subtilis (strain 168) OX=224308 GN=iolX PE=1 SV=2
14	AFDB:Q9UT60	0.725	0.598	6.654E-15	368	0.209	0.168	Q9UT60.pdb.gz	XDH_SCHPO Probable D-xylose 1-dehydrogenase (NADP(+)) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dhd1 PE=3 SV=1
15	PDB:3oa2B	0.709	0.678	1.352E-14	311	0.172	0.164	3oa2B.pdb.gz	Structural and Functional Studies of WlbA: A Dehydrogenase Involved in the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid .
16	AFDB:G3XD23	0.704	0.664	1.534E-14	316	0.166	0.155	G3XD23.pdb.gz	WBPB_PSEAE UDP-N-acetyl-2-amino-2-deoxy-D-glucuronate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpB PE=1 SV=1
17	PDB:3gfgB	0.759	0.657	3.510E-14	350	0.172	0.146	3gfgB.pdb.gz
18	PDB:1ydwB	0.714	0.618	1.799E-12	350	0.149	0.126	1ydwB.pdb.gz
19	PDB:3v2uA	0.739	0.557	2.899E-12	409	0.159	0.115	3v2uA.pdb.gz	The Gal3p transducer of the GAL regulon interacts with the Gal80p repressor in its ligand-induced closed conformation.
20	PDB:3btsA	0.769	0.612	2.076E-11	384	0.152	0.117	3btsA.pdb.gz	NADP regulates the yeast GAL induction system.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJF4	0.0	600	296	1.000	1.000	A0A140VJF4_HUMAN Biliverdin reductase A OS=Homo sapiens OX=9606 PE=2 SV=1
2	P53004	0.0	600	296	1.000	1.000	BIEA_HUMAN Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2
3	Q9CY64	5.64e-175	487	295	0.824	0.827	BIEA_MOUSE Biliverdin reductase A OS=Mus musculus OX=10090 GN=Blvra PE=1 SV=1
4	P46844	8.64e-174	484	295	0.831	0.834	BIEA_RAT Biliverdin reductase A OS=Rattus norvegicus OX=10116 GN=Blvra PE=1 SV=1
5	C9J1E1	4.14e-69	211	102	0.345	1.000	C9J1E1_HUMAN Biliverdin reductase A (Fragment) OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=1
6	P46853	1.57e-09	60.5	345	0.145	0.125	YHHX_ECOLI Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1
7	O42896	1.35e-05	48.5	368	0.078	0.062	YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
8	O13991	1.84e-05	48.1	369	0.081	0.065	YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
9	Q9KWL3	7.75e-05	45.8	315	0.108	0.102	LIGC_SPHSK 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase OS=Sphingobium sp. (strain NBRC 103272 / SYK-6) OX=627192 GN=ligC PE=1 SV=1
10	P77376	5.99e-04	43.1	346	0.081	0.069	YDGJ_ECOLI Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) OX=83333 GN=ydgJ PE=1 SV=2
11	O32223	0.001	42.4	358	0.111	0.092	IOLW_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) IolW OS=Bacillus subtilis (strain 168) OX=224308 GN=iolW PE=1 SV=1
12	O05265	0.002	41.6	328	0.084	0.076	IOLU_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) IolU OS=Bacillus subtilis (strain 168) OX=224308 GN=iolU PE=1 SV=2
13	Q9DBB8	0.003	41.2	333	0.132	0.117	DHDH_MOUSE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus OX=10090 GN=Dhdh PE=1 SV=1
14	P77503	0.083	36.6	351	0.061	0.051	YCJS_ECOLI D-glucoside 3-dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=ycjS PE=1 SV=1
15	Q6FIJ0	0.088	36.6	349	0.139	0.117	Q6FIJ0_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M14025g PE=4 SV=1
16	P40332	0.12	36.2	342	0.101	0.088	IOLX_BACSU scyllo-inositol 2-dehydrogenase (NAD(+)) OS=Bacillus subtilis (strain 168) OX=224308 GN=iolX PE=1 SV=2
17	Q9UT60	0.12	36.2	368	0.068	0.054	XDH_SCHPO Probable D-xylose 1-dehydrogenase (NADP(+)) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dhd1 PE=3 SV=1
18	Q04869	0.13	36.2	349	0.132	0.112	YM94_YEAST Uncharacterized protein YMR315W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR315W PE=1 SV=1
19	Q9UPN3	0.83	33.9	7388	0.088	0.004	MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4
20	Q8GAK6	0.99	33.5	388	0.091	0.070	XDH_PAENI D-xylose dehydrogenase OS=Paenarthrobacter nicotinovorans OX=29320 GN=xdh PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09166 Biliv-reduc_cat	1.1e-48	175.7	Biliverdin reductase, catalytic
2	PF01408 GFO_IDH_MocA	2e-17	75.4	Oxidoreductase family, NAD-binding Rossmann fold
3	PF03447 NAD_binding_3	1.4e+02	14.5	Homoserine dehydrogenase, NAD binding domain
4	PF13543 SAM_KSR1	1.4e+02	14.0	SAM like domain present in kinase suppressor RAS 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385757

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216117	0.990	Heme oxygenase 1
2	9606.ENSP00000477572	0.984	Heme oxygenase 2
3	9606.ENSP00000263368	0.963	Flavin reductase (NADPH)
4	9606.ENSP00000428056	0.915	Phosphatidylinositol 3-kinase regulatory subunit alpha
5	9606.ENSP00000362508	0.905	UDP-glucuronosyltransferase 1-4
6	9606.ENSP00000340660	0.884	Epididymal sperm-binding protein 1
7	9606.ENSP00000304845	0.840	UDP-glucuronosyltransferase 1-1
8	9606.ENSP00000381070	0.830	Dual specificity mitogen-activated protein kinase kinase 7
9	9606.ENSP00000362549	0.816	UDP-glucuronosyltransferase 1-8
10	9606.ENSP00000383178	0.815	Protein diaphanous homolog 3
11	9606.ENSP00000303174	0.812	UDP-glucuronosyltransferase 1-6
12	9606.ENSP00000441269	0.768	Solute carrier organic anion transporter family member
13	9606.ENSP00000261196	0.757	Solute carrier organic anion transporter family member 1B3
14	9606.ENSP00000256958	0.754	Solute carrier organic anion transporter family member 1B1
15	9606.ENSP00000475028	0.730	UDP glucuronosyltransferase 2 family, polypeptide A2
16	9606.ENSP00000251566	0.687	UDP-glucuronosyltransferase 2A3
17	9606.ENSP00000265403	0.687	UDP-glucuronosyltransferase 2B10
18	9606.ENSP00000304811	0.687	UDP-glucuronosyltransferase 2B7
19	9606.ENSP00000305221	0.687	UDP-glucuronosyltransferase 2B4
20	9606.ENSP00000320401	0.687	UDP-glucuronosyltransferase 2B17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004074	1.000	biliverdin reductase (NAD(P)+) activity
GO:0005488	0.997	binding
GO:0005515	0.976	protein binding
GO:0106276	0.880	biliberdin reductase NAD+ activity
GO:1901363	0.442	heterocyclic compound binding
GO:0097159	0.440	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042440	0.996	pigment metabolic process
GO:0033013	0.995	tetrapyrrole metabolic process
GO:0042168	0.993	heme metabolic process
GO:1901361	0.990	organic cyclic compound catabolic process
GO:0046700	0.990	heterocycle catabolic process
GO:0019439	0.988	aromatic compound catabolic process
GO:1901565	0.987	organonitrogen compound catabolic process
GO:0044270	0.987	cellular nitrogen compound catabolic process
GO:0042167	0.479	heme catabolic process
GO:0044238	0.390	primary metabolic process
GO:0065007	0.305	biological regulation
GO:0044281	0.304	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005576	0.542	extracellular region
GO:0016020	0.493	membrane
GO:0070013	0.450	intracellular organelle lumen
GO:0005634	0.371	nucleus
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.1.24	1.000	biliverdin reductase.
RHEA:15797	0.880	bilirubin IXalpha + NAD(+) = biliverdin IXalpha + H(+) + NADH

[back to server]