StarFunc result for job id P53007

User Input

>input (311 residues)
MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSH
PPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLD
STRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGT
YQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTP
LDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEV
VKLLNKVWKTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32089	0.936	0.936	1.432E-37	311	0.955	0.955	P32089.pdb.gz	TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a1 PE=1 SV=1
2	AFDB:F1R4U0	0.971	0.953	7.407E-35	317	0.833	0.817	F1R4U0.pdb.gz	TXTPB_DANRE Tricarboxylate transport protein B, mitochondrial OS=Danio rerio OX=7955 GN=slc25a1b PE=3 SV=2
3	AFDB:Q6PGY3	0.881	0.772	1.251E-30	359	0.768	0.666	Q6PGY3.pdb.gz	TXTPA_DANRE Tricarboxylate transport protein A, mitochondrial OS=Danio rerio OX=7955 GN=slc25a1a PE=2 SV=1
4	AFDB:Q7KSQ0	0.877	0.862	2.631E-27	317	0.650	0.637	Q7KSQ0.pdb.gz	Q7KSQ0_DROME LD46175p OS=Drosophila melanogaster OX=7227 GN=sea PE=1 SV=1
5	AFDB:P38152	0.811	0.841	8.520E-19	299	0.363	0.378	P38152.pdb.gz	TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTP1 PE=2 SV=3
6	AFDB:A0A1D8PJV4	0.817	0.861	1.831E-18	294	0.376	0.398	A0A1D8PJV4.pdb.gz	A0A1D8PJV4_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTP1 PE=3 SV=1
7	AFDB:O13844	0.769	0.818	3.615E-18	291	0.363	0.388	O13844.pdb.gz	YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19G12.05 PE=3 SV=1
8	AFDB:Q8J2Q9	0.743	0.754	4.632E-17	306	0.325	0.330	Q8J2Q9.pdb.gz	FUM11_GIBM7 Tricarboxylate transporter FUM11 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUM11 PE=3 SV=2
9	AFDB:P33303	0.756	0.733	1.389E-15	322	0.318	0.307	P33303.pdb.gz	SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFC1 PE=1 SV=2
10	AFDB:A0A1D8PNY6	0.759	0.778	2.413E-15	303	0.305	0.314	A0A1D8PNY6.pdb.gz	A0A1D8PNY6_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFC1 PE=3 SV=1
11	PDB:2c3eA	0.692	0.729	9.071E-10	293	0.235	0.249	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
12	PDB:4c9qB	0.697	0.741	2.858E-9	290	0.186	0.200	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.520	0.544	1.554E-7	292	0.215	0.229	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.523	0.541	2.048E-4	297	0.235	0.246	2lckA.pdb.gz
15	PDB:7ehlA	0.165	0.104	4.689E-1	563	0.116	0.064	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
16	PDB:7ajlAAA	0.151	0.157	6.051E-1	290	0.100	0.107	7ajlAAA.pdb.gz
17	PDB:7vqxR	0.179	0.161	7.485E-1	361	0.113	0.097	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
18	PDB:7p5cA	0.127	0.103	8.149E-1	392	0.125	0.099	7p5cA.pdb.gz
19	PDB:6ikoA	0.162	0.165	8.502E-1	303	0.080	0.083	6ikoA.pdb.gz
20	PDB:5iztA	0.193	0.240	9.659E-1	211	0.055	0.081	5iztA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R4U0	0.0	524	317	0.830	0.814	TXTPB_DANRE Tricarboxylate transport protein B, mitochondrial OS=Danio rerio OX=7955 GN=slc25a1b PE=3 SV=2
2	P32089	0.0	590	311	0.955	0.955	TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a1 PE=1 SV=1
3	P53007	0.0	642	311	1.000	1.000	TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2
4	P79110	0.0	609	311	0.945	0.945	TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A1 PE=1 SV=1
5	Q8JZU2	0.0	582	311	0.942	0.942	TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a1 PE=1 SV=1
6	Q6PGY3	6.27e-178	497	359	0.765	0.663	TXTPA_DANRE Tricarboxylate transport protein A, mitochondrial OS=Danio rerio OX=7955 GN=slc25a1a PE=2 SV=1
7	Q7KSQ0	1.58e-143	409	317	0.637	0.625	Q7KSQ0_DROME LD46175p OS=Drosophila melanogaster OX=7227 GN=sea PE=1 SV=1
8	O13844	1.58e-68	217	291	0.367	0.392	YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19G12.05 PE=3 SV=1
9	A0A1D8PJV4	1.73e-67	214	294	0.379	0.401	A0A1D8PJV4_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTP1 PE=3 SV=1
10	P38152	8.57e-67	213	299	0.363	0.378	TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTP1 PE=2 SV=3
11	G8B6G7	2.45e-51	174	318	0.328	0.321	G8B6G7_CANPC Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=SFC1 PE=3 SV=1
12	P33303	2.16e-50	171	322	0.331	0.320	SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFC1 PE=1 SV=2
13	A0A1D8PNY6	1.19e-49	169	303	0.305	0.314	A0A1D8PNY6_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFC1 PE=3 SV=1
14	Q8J2Q9	4.32e-47	162	306	0.318	0.324	FUM11_GIBM7 Tricarboxylate transporter FUM11 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUM11 PE=3 SV=2
15	C8VCR9	6.16e-45	157	323	0.334	0.322	C8VCR9_EMENI Mitochondrial succinate-fumarate antiporter (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07287 PE=3 SV=1
16	Q9M038	9.94e-41	145	309	0.302	0.304	SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=SFC1 PE=2 SV=1
17	Q6I583	1.00e-31	123	355	0.296	0.259	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
18	Q8BZ09	1.75e-31	121	298	0.283	0.295	ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a21 PE=1 SV=1
19	Q9DB41	4.09e-31	120	320	0.277	0.269	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
20	Q505J6	1.25e-30	119	320	0.273	0.266	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	7.8e-59	206.9	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215882

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253792	0.884	ATP-citrate synthase
2	9606.ENSP00000442050	0.801	Ethanolamine-phosphate cytidylyltransferase
3	9606.ENSP00000252137	0.765	Protein DGCR14
4	9606.ENSP00000333401	0.765	Mitochondrial ribosomal protein L40
5	9606.ENSP00000406220	0.753	Solute carrier family 13 member 5
6	9606.ENSP00000263196	0.728	Integral membrane protein DGCR2/IDD
7	9606.ENSP00000403645	0.713	Transport and golgi organization 2 homolog
8	9606.ENSP00000479606	0.706	Clathrin heavy chain 1
9	9606.ENSP00000348211	0.699	Solute carrier family 25 member 46
10	9606.ENSP00000342056	0.685	Citrate synthase, mitochondrial
11	9606.ENSP00000304592	0.671	Fatty acid synthase
12	9606.ENSP00000379208	0.668	Zinc finger protein 248
13	9606.ENSP00000367991	0.662	Septin-8
14	9606.ENSP00000348849	0.657	Ribosomal protein S26
15	9606.ENSP00000358909	0.653	Sideroflexin-2
16	9606.ENSP00000086933	0.647	Homeobox protein goosecoid-2
17	9606.ENSP00000274569	0.644	Prenylcysteine oxidase-like
18	9606.ENSP00000290607	0.644	StAR-related lipid transfer protein 9
19	9606.ENSP00000263208	0.639	Protein HIRA
20	9606.ENSP00000331791	0.630	T-box transcription factor TBX1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015291	0.999	secondary active transmembrane transporter activity
GO:0046943	0.999	carboxylic acid transmembrane transporter activity
GO:1901702	0.995	salt transmembrane transporter activity
GO:0005488	0.909	binding
GO:0005515	0.723	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:1990542	0.993	mitochondrial transmembrane transport
GO:1905039	0.967	carboxylic acid transmembrane transport
GO:0008152	0.666	metabolic process
GO:0071704	0.575	organic substance metabolic process
GO:0071705	0.559	nitrogen compound transport
GO:0044237	0.529	cellular metabolic process
GO:0044238	0.440	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.969	membrane
GO:0043233	0.933	organelle lumen
GO:0070013	0.921	intracellular organelle lumen
GO:0031090	0.892	organelle membrane
GO:0031967	0.629	organelle envelope
GO:0005576	0.549	extracellular region
GO:0031982	0.544	vesicle
GO:0031966	0.515	mitochondrial membrane
GO:1903561	0.438	extracellular vesicle
GO:0019866	0.429	organelle inner membrane
GO:0005743	0.412	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]