StarFunc result for job id P53355

User Input

>input (1430 residues)
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80YE7	0.820	0.814	0.000	1442	0.951	0.943	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
2	AFDB:A0A024R603	0.219	0.836	1.142E-37	370	0.167	0.646	A0A024R603.pdb.gz
3	AFDB:E9QHI3	0.206	0.641	5.461E-36	453	0.170	0.536	E9QHI3.pdb.gz	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
4	AFDB:O43293	0.203	0.630	2.148E-35	454	0.169	0.531	O43293.pdb.gz	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1
5	AFDB:O54784	0.206	0.651	1.370E-34	448	0.163	0.520	O54784.pdb.gz	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
6	PDB:2yaaA	0.207	0.983	6.608E-34	300	0.159	0.760	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
7	AFDB:Q8NFD2	0.205	0.367	1.736E-27	765	0.115	0.214	Q8NFD2.pdb.gz	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
8	AFDB:Q8BZ25	0.216	0.402	3.732E-27	745	0.114	0.219	Q8BZ25.pdb.gz	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
9	AFDB:Q9ERK0	0.197	0.343	1.657E-26	786	0.115	0.209	Q9ERK0.pdb.gz	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
10	AFDB:P57078	0.201	0.331	8.191E-24	832	0.113	0.195	P57078.pdb.gz	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
11	AFDB:Q9FY48	0.204	0.181	1.177E-23	1625	0.099	0.087	Q9FY48.pdb.gz	KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana OX=3702 GN=KEG PE=1 SV=2
12	PDB:5u6yA	0.191	0.580	5.102E-19	459	0.073	0.227	5u6yA.pdb.gz
13	PDB:2x4fA	0.183	0.859	5.277E-18	289	0.086	0.426	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
14	PDB:8bfsA	0.174	0.850	2.161E-17	274	0.072	0.376	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
15	PDB:3soaA	0.191	0.606	3.366E-17	436	0.073	0.241	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
16	PDB:8cs9A	0.206	0.358	3.345E-16	796	0.064	0.116	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:4rgjA	0.183	0.542	1.485E-15	463	0.085	0.261	4rgjA.pdb.gz
18	PDB:4zhxA	0.168	0.566	3.192E-15	409	0.067	0.235	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:7myjC	0.166	0.495	1.027E-14	465	0.066	0.202	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
20	PDB:5ufuA	0.166	0.618	1.113E-14	369	0.062	0.241	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53355	0.0	2976	1430	1.000	1.000	DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6
2	Q80YE7	0.0	2797	1442	0.951	0.943	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
3	Q8VDF3	1.16e-173	524	370	0.167	0.646	DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Dapk2 PE=1 SV=1
4	Q9UIK4	9.09e-172	519	370	0.171	0.659	DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=DAPK2 PE=1 SV=1
5	E9QHI3	4.83e-163	499	453	0.162	0.512	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
6	O43293	4.91e-161	494	454	0.159	0.500	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1
7	O54784	6.37e-158	486	448	0.155	0.496	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
8	O88764	7.78e-158	486	448	0.155	0.496	DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Dapk3 PE=1 SV=1
9	O94768	7.31e-78	264	372	0.095	0.366	ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1
10	Q91XS8	1.16e-77	264	371	0.094	0.364	ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus OX=10116 GN=Stk17b PE=1 SV=1
11	G1U9Q7	1.01e-76	284	1903	0.104	0.078	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
12	Q6PDN3	1.86e-76	283	1941	0.099	0.073	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
13	Q15746	1.91e-76	283	1914	0.105	0.078	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
14	Q9GM70	9.52e-76	259	397	0.092	0.332	ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus OX=9986 GN=STK17A PE=2 SV=1
15	Q9UEE5	4.10e-75	258	414	0.092	0.319	ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2
16	G4SLH0	2.72e-72	271	18562	0.090	0.007	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
17	Q86YV6	7.62e-72	248	388	0.086	0.317	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
18	Q9GTV1	1.39e-70	254	732	0.090	0.176	Q9GTV1_DROME Stretchin-MLCK OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
19	Q9GV81	1.78e-70	250	577	0.087	0.217	Q9GV81_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
20	A1ZA70	2.59e-70	253	732	0.090	0.176	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.9e+02	12.5	AAA ATPase domain
2	PF13401 AAA_22	3.3e+02	13.0	AAA domain
3	PF13476 AAA_23	1.7e+02	14.1	AAA domain
4	PF00005 ABC_tran	3.1e+02	13.3	ABC transporter
5	PF00023 Ank	2.2e-31	118.2	Ankyrin repeat
6	PF12796 Ank_2	1.7e-45	164.8	Ankyrin repeats (3 copies)
7	PF13606 Ank_3	1.6e-30	112.5	Ankyrin repeat
8	PF13637 Ank_4	3.4e-42	153.5	Ankyrin repeats (many copies)
9	PF13857 Ank_5	9.8e-43	154.9	Ankyrin repeats (many copies)
10	PF01636 APH	1.8e+02	13.3	Phosphotransferase enzyme family
11	PF01633 Choline_kinase	2e+02	13.0	Choline/ethanolamine kinase
12	PF16095 COR	0.0016	29.8	C-terminal of Roc, COR, domain
13	PF00531 Death	1.6e-17	74.8	Death domain
14	PF06293 Kdo	0.01	26.8	Lipopolysaccharide kinase (Kdo/WaaP) family
15	PF17531 O_Spanin_T7	3.5e+02	12.7	Spanin, outer lipoprotein subunit T7-like virus
16	PF00069 Pkinase	2.5e-70	248.4	Protein kinase domain
17	PF07714 PK_Tyr_Ser-Thr	1.8e-32	124.3	Protein tyrosine and serine/threonine kinase
18	PF01163 RIO1	0.14	23.3	RIO1 family
19	PF08477 Roc	4.1e+02	12.6	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477455	0.987	Glutamate receptor ionotropic, NMDA 2B
2	9606.ENSP00000334329	0.976	Netrin receptor UNC5B
3	9606.ENSP00000349467	0.975	Calmodulin-1
4	9606.ENSP00000355231	0.961	Beclin-1
5	9606.ENSP00000291295	0.960	Calmodulin 3 (phosphorylase kinase, delta)
6	9606.ENSP00000263025	0.950	Mitogen-activated protein kinase 3
7	9606.ENSP00000269305	0.944	Cellular tumor antigen p53
8	9606.ENSP00000173229	0.930	Netrin-1
9	9606.ENSP00000209884	0.893	Kelch-like protein 20
10	9606.ENSP00000272298	0.884	Calmodulin 2 (phosphorylase kinase, delta)
11	9606.ENSP00000215832	0.883	Mitogen-activated protein kinase 1
12	9606.ENSP00000219476	0.882	Tuberin
13	9606.ENSP00000301838	0.870	FAS-associated death domain protein
14	9606.ENSP00000328551	0.844	Ras-related protein Rab-28
15	9606.ENSP00000349547	0.828	Ras association domain-containing protein 1
16	9606.ENSP00000442973	0.807	Death-associated protein kinase 3
17	9606.ENSP00000302111	0.806	Methylated-DNA--protein-cysteine methyltransferase
18	9606.ENSP00000261891	0.804	Death-associated protein kinase 2
19	9606.ENSP00000296755	0.789	Microtubule-associated protein 1B
20	9606.ENSP00000311032	0.775	Caspase-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005516	1.000	calmodulin binding
GO:0004672	1.000	protein kinase activity
GO:0005524	1.000	ATP binding
GO:0004674	0.986	protein serine/threonine kinase activity
GO:0042802	0.855	identical protein binding
GO:0019899	0.730	enzyme binding
GO:0017075	0.351	syntaxin-1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0065009	0.991	regulation of molecular function
GO:0002376	0.990	immune system process
GO:0051716	0.989	cellular response to stimulus
GO:0006915	0.989	apoptotic process
GO:0008152	0.988	metabolic process
GO:0010941	0.977	regulation of cell death
GO:0097190	0.977	apoptotic signaling pathway
GO:0071346	0.973	cellular response to type II interferon
GO:0071704	0.970	organic substance metabolic process
GO:0048519	0.959	negative regulation of biological process
GO:0043067	0.947	regulation of programmed cell death
GO:0080090	0.944	regulation of primary metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0044238	0.939	primary metabolic process
GO:0044237	0.935	cellular metabolic process
GO:0043170	0.931	macromolecule metabolic process
GO:0042981	0.928	regulation of apoptotic process
GO:0006807	0.926	nitrogen compound metabolic process
GO:0048523	0.922	negative regulation of cellular process
GO:0043412	0.914	macromolecule modification
GO:1901564	0.903	organonitrogen compound metabolic process
GO:0048583	0.898	regulation of response to stimulus
GO:0048518	0.895	positive regulation of biological process
GO:0036211	0.885	protein modification process
GO:0006468	0.872	protein phosphorylation
GO:0031323	0.868	regulation of cellular metabolic process
GO:0048522	0.811	positive regulation of cellular process
GO:0035556	0.807	intracellular signal transduction
GO:0051246	0.799	regulation of protein metabolic process
GO:0009966	0.575	regulation of signal transduction
GO:0009893	0.542	positive regulation of metabolic process
GO:0010604	0.523	positive regulation of macromolecule metabolic process
GO:0051173	0.513	positive regulation of nitrogen compound metabolic process
GO:0010556	0.491	regulation of macromolecule biosynthetic process
GO:0044093	0.449	positive regulation of molecular function
GO:0010468	0.441	regulation of gene expression
GO:0031326	0.429	regulation of cellular biosynthetic process
GO:0031325	0.397	positive regulation of cellular metabolic process
GO:0009892	0.393	negative regulation of metabolic process
GO:0050790	0.317	regulation of catalytic activity
GO:0010605	0.312	negative regulation of macromolecule metabolic process
GO:0051172	0.309	negative regulation of nitrogen compound metabolic process
GO:0019219	0.307	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0005886	0.990	plasma membrane
GO:0032991	0.985	protein-containing complex
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005829	0.971	cytosol
GO:0005856	0.954	cytoskeleton
GO:0043231	0.943	intracellular membrane-bounded organelle
GO:0070013	0.932	intracellular organelle lumen
GO:1902494	0.928	catalytic complex
GO:0005634	0.708	nucleus
GO:1990234	0.643	transferase complex
GO:0031981	0.544	nuclear lumen
GO:0005654	0.481	nucleoplasm
GO:1902911	0.480	protein kinase complex
GO:0045202	0.459	synapse
GO:0015629	0.357	actin cytoskeleton
GO:1902554	0.308	serine/threonine protein kinase complex
GO:0012505	0.302	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]