StarFunc result for job id P53370

User Input

>input (316 residues)
MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRL
ARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAES
DSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEP
EEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPYSFTINFCQ
EECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGLFYKL
YHKELPENYKTMKGID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53370	1.000	1.000	7.987E-68	316	1.000	1.000	P53370.pdb.gz	NUDT6_HUMAN Nucleoside diphosphate-linked moiety X motif 6 OS=Homo sapiens OX=9606 GN=NUDT6 PE=1 SV=2
2	AFDB:Q9SU14	0.745	0.830	1.588E-28	282	0.256	0.287	Q9SU14.pdb.gz	NUDT7_ARATH Nudix hydrolase 7 OS=Arabidopsis thaliana OX=3702 GN=NUDT7 PE=1 SV=1
3	AFDB:Q8L7W2	0.759	0.655	3.645E-28	369	0.304	0.260	Q8L7W2.pdb.gz	NUDT8_ARATH Nudix hydrolase 8 OS=Arabidopsis thaliana OX=3702 GN=NUDT8 PE=2 SV=2
4	AFDB:Q94B74	0.727	0.822	1.125E-27	278	0.250	0.284	Q94B74.pdb.gz	NUDT2_ARATH Nudix hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=NUDT2 PE=1 SV=1
5	AFDB:Q6NPD7	0.741	0.840	6.289E-27	277	0.237	0.271	Q6NPD7.pdb.gz	NUD10_ARATH Nudix hydrolase 10 OS=Arabidopsis thaliana OX=3702 GN=NUDT10 PE=1 SV=1
6	AFDB:Q9SJC4	0.729	0.809	6.289E-27	283	0.259	0.290	Q9SJC4.pdb.gz	NUDT6_ARATH Nudix hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=NUDT6 PE=1 SV=1
7	AFDB:F4JRE7	0.706	0.694	7.515E-27	322	0.259	0.255	F4JRE7.pdb.gz	F4JRE7_ARATH Nudix hydrolase OS=Arabidopsis thaliana OX=3702 GN=NUDT7 PE=1 SV=1
8	PDB:4zbpB	0.698	0.807	5.021E-25	270	0.263	0.307	4zbpB.pdb.gz	Crystal Structures of Arabidopsis thaliana Nudix Hydrolase NUDT7 Reveal a Previously Unobserved Conformation.
9	AFDB:Q75UV1	0.353	0.838	4.486E-10	126	0.104	0.262	Q75UV1.pdb.gz	NDX1_THETH Diadenosine hexaphosphate hydrolase OS=Thermus thermophilus OX=274 GN=ndx1 PE=1 SV=1
10	AFDB:Q94A82	0.364	0.266	1.092E-9	438	0.092	0.066	Q94A82.pdb.gz	NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT19 PE=1 SV=1
11	PDB:1vc8A	0.354	0.841	1.637E-9	126	0.101	0.254	1vc8A.pdb.gz	Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate
12	PDB:4hfqA	0.344	0.517	1.843E-9	203	0.092	0.143	4hfqA.pdb.gz
13	AFDB:A0A0H2URA0	0.338	0.502	1.977E-9	203	0.089	0.138	A0A0H2URA0.pdb.gz	A0A0H2URA0_STRPN MutT/nudix family protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1669 PE=1 SV=1
14	PDB:3ffuA	0.342	0.732	3.144E-9	133	0.101	0.241	3ffuA.pdb.gz	Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
15	PDB:2rrkA	0.342	0.706	3.987E-9	140	0.082	0.186	2rrkA.pdb.gz
16	PDB:5gp0I	0.342	0.716	1.979E-8	139	0.108	0.245	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
17	PDB:5ltuB	0.311	0.687	5.426E-8	130	0.108	0.262	5ltuB.pdb.gz
18	PDB:2gb5A	0.374	0.439	8.722E-8	265	0.108	0.128	2gb5A.pdb.gz	Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution
19	PDB:2o1cA	0.335	0.671	1.173E-7	147	0.089	0.190	2o1cA.pdb.gz	Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.
20	PDB:7b66A	0.336	0.605	1.245E-7	161	0.082	0.161	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53370	0.0	659	316	1.000	1.000	NUDT6_HUMAN Nucleoside diphosphate-linked moiety X motif 6 OS=Homo sapiens OX=9606 GN=NUDT6 PE=1 SV=2
2	Q9SU14	2.99e-44	154	282	0.244	0.273	NUDT7_ARATH Nudix hydrolase 7 OS=Arabidopsis thaliana OX=3702 GN=NUDT7 PE=1 SV=1
3	Q9SJC4	3.95e-39	141	283	0.247	0.276	NUDT6_ARATH Nudix hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=NUDT6 PE=1 SV=1
4	Q8L7W2	5.60e-39	142	369	0.256	0.220	NUDT8_ARATH Nudix hydrolase 8 OS=Arabidopsis thaliana OX=3702 GN=NUDT8 PE=2 SV=2
5	Q94B74	1.65e-38	139	278	0.231	0.263	NUDT2_ARATH Nudix hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=NUDT2 PE=1 SV=1
6	F4JRE7	1.66e-37	137	322	0.247	0.242	F4JRE7_ARATH Nudix hydrolase OS=Arabidopsis thaliana OX=3702 GN=NUDT7 PE=1 SV=1
7	Q6NPD7	2.10e-33	125	277	0.231	0.264	NUD10_ARATH Nudix hydrolase 10 OS=Arabidopsis thaliana OX=3702 GN=NUDT10 PE=1 SV=1
8	Q75UV1	2.07e-07	51.2	126	0.092	0.230	NDX1_THETH Diadenosine hexaphosphate hydrolase OS=Thermus thermophilus OX=274 GN=ndx1 PE=1 SV=1
9	Q8NFP7	4.03e-06	48.5	164	0.076	0.146	NUD10_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Homo sapiens OX=9606 GN=NUDT10 PE=1 SV=1
10	A0A024RBG1	1.96e-05	46.6	181	0.076	0.133	NUD4B_HUMAN Diphosphoinositol polyphosphate phosphohydrolase NUDT4B OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1
11	Q96G61	3.51e-05	45.8	164	0.073	0.140	NUD11_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Homo sapiens OX=9606 GN=NUDT11 PE=1 SV=1
12	P0AEI6	8.62e-05	44.3	153	0.120	0.248	NUDJ_ECOLI Phosphatase NudJ OS=Escherichia coli (strain K12) OX=83333 GN=nudJ PE=1 SV=1
13	Q8R2U6	1.06e-04	44.7	179	0.073	0.128	NUDT4_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Mus musculus OX=10090 GN=Nudt4 PE=1 SV=1
14	Q9NZJ9	1.13e-04	44.3	180	0.073	0.128	NUDT4_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2
15	P0C027	3.17e-04	42.7	164	0.070	0.134	NUD10_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Mus musculus OX=10090 GN=Nudt10 PE=1 SV=1
16	P0C028	3.17e-04	42.7	164	0.070	0.134	NUD11_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Mus musculus OX=10090 GN=Nudt11 PE=1 SV=1
17	P56380	0.002	40.0	147	0.089	0.190	AP4A_MOUSE Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Mus musculus OX=10090 GN=Nudt2 PE=1 SV=3
18	Q6ZVK8	0.002	41.6	323	0.070	0.068	NUD18_HUMAN 8-oxo-dGDP phosphatase NUDT18 OS=Homo sapiens OX=9606 GN=NUDT18 PE=1 SV=3
19	Q7JVG2	0.002	40.8	177	0.111	0.198	Q7JVG2_DROME diphosphoinositol-polyphosphate diphosphatase OS=Drosophila melanogaster OX=7227 GN=Aps PE=1 SV=1
20	O95989	0.003	40.0	172	0.101	0.186	NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19067 DUF5763	4.4e+02	11.8	Family of unknown function (DUF5763)
2	PF00293 NUDIX	2.4e-14	64.9	NUDIX domain
3	PF14815 NUDIX_4	70	14.8	NUDIX domain
4	PF18290 Nudix_hydro	5.1e-21	85.8	Nudix hydrolase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279206	0.801	Nucleoside diphosphate-linked moiety X motif 22
2	9606.ENSP00000334437	0.790	Nucleoside diphosphate-linked moiety X motif 17
3	9606.ENSP00000480722	0.778	8-oxo-dGDP phosphatase NUDT18
4	9606.ENSP00000357189	0.764	Hepatoma-derived growth factor
5	9606.ENSP00000230792	0.755	Peroxisomal NADH pyrophosphatase NUDT12
6	9606.ENSP00000419628	0.736	ADP-sugar pyrophosphatase
7	9606.ENSP00000239666	0.726	Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33
8	9606.ENSP00000376349	0.723	Uridine diphosphate glucose pyrophosphatase
9	9606.ENSP00000230431	0.716	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
10	9606.ENSP00000259056	0.697	Polypeptide N-acetylgalactosaminyltransferase 5
11	9606.ENSP00000338352	0.648	Diphosphoinositol polyphosphate phosphohydrolase 2
12	9606.ENSP00000303575	0.601	ADP-ribose pyrophosphatase, mitochondrial
13	9606.ENSP00000365081	0.594	Apolipoprotein M
14	9606.ENSP00000476119	0.576	Diphosphoinositol polyphosphate phosphohydrolase 1
15	9606.ENSP00000247153	0.575	Properdin
16	9606.ENSP00000345528	0.567	Solute carrier family 35 member F6
17	9606.ENSP00000264498	0.565	Fibroblast growth factor 2
18	9606.ENSP00000300291	0.555	Cleavage and polyadenylation specificity factor subunit 5
19	9606.ENSP00000360645	0.548	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
20	9606.ENSP00000331614	0.540	DNA-binding protein Ikaros

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	1.000	pyrophosphatase activity
GO:0005515	0.997	protein binding
GO:1901363	0.639	heterocyclic compound binding
GO:0097159	0.638	organic cyclic compound binding
GO:0043167	0.635	ion binding
GO:0043169	0.499	cation binding
GO:0046872	0.465	metal ion binding
GO:0017076	0.311	purine nucleotide binding
GO:0042802	0.307	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048523	0.984	negative regulation of cellular process
GO:0042127	0.916	regulation of cell population proliferation
GO:0045786	0.916	negative regulation of cell cycle
GO:0008285	0.913	negative regulation of cell population proliferation
GO:0009987	0.755	cellular process
GO:0071704	0.458	organic substance metabolic process
GO:0044238	0.428	primary metabolic process
GO:0006807	0.374	nitrogen compound metabolic process
GO:0044237	0.359	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0070013	0.717	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	1.000	In phosphorus-containing anhydrides.

[back to server]