StarFunc result for job id P53384

User Input

>input (320 residues)
MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVL
SGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPV
YVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEH
LSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKK
ESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSII
QRIQEFCNLHQSKEENLISS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53384	1.000	1.000	5.172E-66	320	1.000	1.000	P53384.pdb.gz	NUBP1_HUMAN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2
2	AFDB:Q9R060	0.969	0.969	1.074E-57	320	0.891	0.891	Q9R060.pdb.gz	NUBP1_MOUSE Cytosolic Fe-S cluster assembly factor NUBP1 OS=Mus musculus OX=10090 GN=Nubp1 PE=1 SV=1
3	AFDB:Q93459	0.906	0.926	3.217E-45	313	0.516	0.527	Q93459.pdb.gz	NUBP1_CAEEL Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis elegans OX=6239 GN=nubp-1 PE=2 SV=2
4	AFDB:O94442	0.896	0.905	3.837E-45	317	0.572	0.577	O94442.pdb.gz	NBP35_SCHPO Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nbp35 PE=3 SV=1
5	AFDB:P52920	0.895	0.873	8.236E-45	328	0.512	0.500	P52920.pdb.gz	NBP35_YEAST Cytosolic Fe-S cluster assembly factor NBP35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NBP35 PE=1 SV=1
6	AFDB:Q8H1Q2	0.841	0.772	6.673E-42	350	0.562	0.514	Q8H1Q2.pdb.gz	NBP35_ARATH Cytosolic Fe-S cluster assembly factor NBP35 OS=Arabidopsis thaliana OX=3702 GN=NBP35 PE=1 SV=1
7	AFDB:Q9VJI9	0.828	0.851	1.007E-41	311	0.531	0.547	Q9VJI9.pdb.gz	NUBP1_DROME Cytosolic Fe-S cluster assembly factor Nubp1 homolog OS=Drosophila melanogaster OX=7227 GN=Nubp1 PE=1 SV=1
8	AFDB:Q38C73	0.907	0.929	8.064E-38	312	0.428	0.439	Q38C73.pdb.gz	Q38C73_TRYB2 Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6210 PE=3 SV=1
9	AFDB:Q9Y5Y2	0.782	0.921	1.995E-34	271	0.416	0.491	Q9Y5Y2.pdb.gz	NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1
10	AFDB:Q9R061	0.788	0.914	3.549E-33	275	0.397	0.462	Q9R061.pdb.gz	NUBP2_MOUSE Cytosolic Fe-S cluster assembly factor NUBP2 OS=Mus musculus OX=10090 GN=Nubp2 PE=1 SV=1
11	PDB:7ejwA	0.540	0.621	1.490E-10	274	0.197	0.230	7ejwA.pdb.gz	The antiactivator FleN uses an allosteric mechanism to regulate sigma 54 -dependent expression of flagellar genes in Pseudomonas aeruginosa .
12	PDB:3q9lA	0.582	0.711	1.580E-10	257	0.163	0.202	3q9lA.pdb.gz	Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
13	PDB:2afhE	0.509	0.558	5.964E-8	289	0.109	0.121	2afhE.pdb.gz	Nitrogenase Complexes: Multiple Docking Sites for a Nucleotide Switch Protein
14	PDB:3ug7A	0.466	0.470	1.265E-6	317	0.175	0.177	3ug7A.pdb.gz	Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue.
15	PDB:3ez2B	0.463	0.392	1.698E-6	394	0.169	0.137	3ez2B.pdb.gz	Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
16	PDB:3sjbA	0.448	0.493	2.025E-6	288	0.141	0.156	3sjbA.pdb.gz
17	PDB:3ndbB	0.393	0.311	2.880E-6	420	0.141	0.107	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
18	PDB:3ibgA	0.425	0.450	4.346E-6	300	0.178	0.190	3ibgA.pdb.gz	Model for eukaryotic tail-anchored protein binding based on the structure of Get3
19	PDB:6so5B	0.446	0.485	7.373E-6	292	0.150	0.164	6so5B.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
20	PDB:4xtrA	0.455	0.472	8.794E-6	305	0.150	0.157	4xtrA.pdb.gz	Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53384	0.0	658	320	1.000	1.000	NUBP1_HUMAN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2
2	Q9R060	0.0	599	320	0.891	0.891	NUBP1_MOUSE Cytosolic Fe-S cluster assembly factor NUBP1 OS=Mus musculus OX=10090 GN=Nubp1 PE=1 SV=1
3	O94442	3.80e-137	393	317	0.562	0.568	NBP35_SCHPO Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nbp35 PE=3 SV=1
4	Q93459	1.09e-128	371	313	0.528	0.540	NUBP1_CAEEL Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis elegans OX=6239 GN=nubp-1 PE=2 SV=2
5	P52920	2.02e-124	361	328	0.512	0.500	NBP35_YEAST Cytosolic Fe-S cluster assembly factor NBP35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NBP35 PE=1 SV=1
6	Q8H1Q2	5.36e-123	358	350	0.569	0.520	NBP35_ARATH Cytosolic Fe-S cluster assembly factor NBP35 OS=Arabidopsis thaliana OX=3702 GN=NBP35 PE=1 SV=1
7	Q9VJI9	7.31e-113	331	311	0.519	0.534	NUBP1_DROME Cytosolic Fe-S cluster assembly factor Nubp1 homolog OS=Drosophila melanogaster OX=7227 GN=Nubp1 PE=1 SV=1
8	Q9Y5Y2	6.53e-94	281	271	0.419	0.494	NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1
9	Q38C73	5.32e-92	278	312	0.422	0.433	Q38C73_TRYB2 Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6210 PE=3 SV=1
10	Q9R061	9.74e-89	268	275	0.400	0.465	NUBP2_MOUSE Cytosolic Fe-S cluster assembly factor NUBP2 OS=Mus musculus OX=10090 GN=Nubp2 PE=1 SV=1
11	Q9VPD2	9.79e-85	258	260	0.403	0.496	NUBP2_DROME Cytosolic Fe-S cluster assembly factor Nubp2 homolog OS=Drosophila melanogaster OX=7227 GN=Nubp2 PE=1 SV=1
12	Q57WQ0	3.95e-83	254	289	0.388	0.429	Q57WQ0_TRYB2 Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.840 PE=3 SV=1
13	Q4Q9E8	8.31e-83	254	308	0.422	0.438	Q4Q9E8_LEIMA Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Leishmania major OX=5664 GN=LMJF_26_0430 PE=3 SV=1
14	P40558	5.63e-81	249	293	0.366	0.399	CFD1_YEAST Cytosolic Fe-S cluster assembly factor CFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CFD1 PE=1 SV=1
15	Q9UT57	5.64e-76	246	608	0.375	0.197	CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.02c PE=3 SV=1
16	Q8TB37	1.09e-53	180	319	0.378	0.379	NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens OX=9606 GN=NUBPL PE=1 SV=3
17	X5D2R5	1.09e-53	180	319	0.378	0.379	X5D2R5_HUMAN Nucleotide binding protein-like isoform A (Fragment) OS=Homo sapiens OX=9606 GN=NUBPL PE=2 SV=1
18	Q9CWD8	7.53e-53	178	319	0.369	0.370	NUBPL_MOUSE Iron-sulfur protein NUBPL OS=Mus musculus OX=10090 GN=Nubpl PE=1 SV=2
19	P0AF08	3.37e-50	172	369	0.303	0.263	APBC_ECOLI Iron-sulfur cluster carrier protein OS=Escherichia coli (strain K12) OX=83333 GN=mrp PE=3 SV=1
20	O49472	8.81e-50	169	313	0.316	0.323	INDH_ARATH Iron-sulfur protein required for NADH dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=INDH PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.6e+02	12.9	AAA ATPase domain
2	PF13401 AAA_22	6.5e+02	12.0	AAA domain
3	PF13481 AAA_25	19	16.3	AAA domain
4	PF13500 AAA_26	11	17.3	AAA domain
5	PF13614 AAA_31	1.4e-05	36.6	AAA domain
6	PF02374 ArsA_ATPase	0.002	29.0	Anion-transporting ATPase
7	PF01656 CbiA	3.3e-08	45.1	CobQ/CobB/MinD/ParA nucleotide binding domain
8	PF06564 CBP_BcsQ	1.4e+02	13.4	Cellulose biosynthesis protein BcsQ
9	PF16575 CLP1_P	13	17.1	mRNA cleavage and polyadenylation factor CLP1 P-loop
10	PF10236 DAP3	1.7e+02	12.8	Mitochondrial ribosomal death-associated protein 3
11	PF03796 DnaB_C	5.6e+02	11.2	DnaB-like helicase C terminal domain
12	PF01935 DUF87	78	14.8	Helicase HerA, central domain
13	PF00142 Fer4_NifH	1.1	20.2	4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
14	PF09140 MipZ	0.4	21.5	ATPase MipZ
15	PF05729 NACHT	65	14.9	NACHT domain
16	PF00931 NB-ARC	48	14.6	NB-ARC domain
17	PF10609 ParA	5.1e-96	332.4	NUBPL iron-transfer P-loop NTPase
18	PF01884 PcrB	1e+02	13.8	PcrB family
19	PF00910 RNA_helicase	3.4e+02	13.1	RNA helicase
20	PF03193 RsgA_GTPase	2.3	19.6	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251588	0.999	Cytosolic Fe-S cluster assembly factor NARFL
2	9606.ENSP00000377914	0.997	Anamorsin
3	9606.ENSP00000412698	0.991	MMS19 nucleotide excision repair protein homolog
4	9606.ENSP00000418287	0.991	Probable cytosolic iron-sulfur protein assembly protein CIAO1
5	9606.ENSP00000253577	0.989	ATP-binding cassette sub-family B member 7, mitochondrial
6	9606.ENSP00000360576	0.988	NADPH-dependent diflavin oxidoreductase 1
7	9606.ENSP00000387471	0.985	Mitotic spindle-associated MMXD complex subunit MIP18
8	9606.ENSP00000406046	0.954	DNA polymerase delta catalytic subunit
9	9606.ENSP00000353332	0.942	Regulator of telomere elongation helicase 1
10	9606.ENSP00000259008	0.941	Fanconi anemia group J protein
11	9606.ENSP00000262302	0.933	Cytosolic Fe-S cluster assembly factor NUBP2
12	9606.ENSP00000375809	0.919	TFIIH basal transcription factor complex helicase XPD subunit
13	9606.ENSP00000363205	0.888	Cysteine desulfurase, mitochondrial
14	9606.ENSP00000420026	0.875	LYR motif-containing protein 4
15	9606.ENSP00000310623	0.870	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
16	9606.ENSP00000296577	0.823	ATP-binding cassette sub-family E member 1
17	9606.ENSP00000387219	0.814	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
18	9606.ENSP00000357633	0.794	Glutaredoxin-3
19	9606.ENSP00000216027	0.777	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
20	9606.ENSP00000263578	0.768	FAD-dependent oxidoreductase domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000166	0.997	nucleotide binding
GO:0051536	0.995	iron-sulfur cluster binding
GO:0003824	0.940	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044237	0.988	cellular metabolic process
GO:0071840	0.955	cellular component organization or biogenesis
GO:0031163	0.951	metallo-sulfur cluster assembly
GO:0016226	0.944	iron-sulfur cluster assembly
GO:0065007	0.942	biological regulation
GO:0050789	0.927	regulation of biological process
GO:0050794	0.907	regulation of cellular process
GO:0071704	0.610	organic substance metabolic process
GO:0051128	0.597	regulation of cellular component organization
GO:0044238	0.560	primary metabolic process
GO:0006807	0.547	nitrogen compound metabolic process
GO:0043170	0.429	macromolecule metabolic process
GO:1901360	0.318	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.953	organelle
GO:0043229	0.939	intracellular organelle
GO:0016020	0.931	membrane
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0071944	0.826	cell periphery
GO:0005886	0.800	plasma membrane
GO:0005634	0.712	nucleus
GO:0043233	0.435	organelle lumen
GO:0070013	0.433	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]