StarFunc result for job id P53396

User Input

>input (1101 residues)
MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPD
QLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVP
SPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
IPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYV
SRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIG
GTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASF
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADH
GPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFV
NKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPN
LILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLK
QGLYRHPWDDISYVLPEHMSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6qfbB	0.915	0.973	0.000	1035	0.939	0.999	6qfbB.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
2	PDB:6qfbC	0.878	0.954	0.000	1011	0.918	1.000	6qfbC.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
3	AFDB:A0A024R1T9	0.979	0.979	0.000	1101	1.000	1.000	A0A024R1T9.pdb.gz
4	AFDB:A0A060W7T9	0.974	0.966	0.000	1110	0.856	0.849	A0A060W7T9.pdb.gz	A0A060W7T9_ONCMY ATP-citrate synthase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00064821001 PE=3 SV=1
5	AFDB:Q7KN85	0.946	0.937	0.000	1112	0.698	0.692	Q7KN85.pdb.gz	Q7KN85_DROME ATP-citrate synthase OS=Drosophila melanogaster OX=7227 GN=ATPCL PE=1 SV=1
6	AFDB:Q9P7W3	0.548	0.979	2.189E-89	615	0.360	0.644	Q9P7W3.pdb.gz	ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1703.07 PE=1 SV=1
7	AFDB:Q5BAJ4	0.553	0.925	1.720E-87	655	0.366	0.615	Q5BAJ4.pdb.gz	Q5BAJ4_EMENI ATP citrate synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02436 PE=4 SV=1
8	AFDB:Q9C522	0.542	0.974	4.651E-78	608	0.292	0.530	Q9C522.pdb.gz	ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACLB-1 PE=2 SV=1
9	AFDB:Q54YA0	0.546	0.959	4.896E-78	622	0.298	0.527	Q54YA0.pdb.gz	ACLY_DICDI Probable ATP-citrate synthase OS=Dictyostelium discoideum OX=44689 GN=acly PE=1 SV=1
10	AFDB:Q8KDG2	0.469	0.800	1.194E-55	610	0.197	0.356	Q8KDG2.pdb.gz	Q8KDG2_CHLTE Citrate lyase, subunit2 OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1088 PE=4 SV=1
11	AFDB:Q5BAJ5	0.370	0.822	2.420E-50	485	0.210	0.476	Q5BAJ5.pdb.gz	Q5BAJ5_EMENI ATP citrate synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02435 PE=4 SV=1
12	AFDB:O13907	0.366	0.804	4.044E-50	492	0.209	0.467	O13907.pdb.gz	ACL2_SCHPO Probable ATP-citrate synthase subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22A12.16 PE=1 SV=1
13	PDB:1jkjB	0.300	0.778	3.972E-19	388	0.074	0.211	1jkjB.pdb.gz	Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.
14	PDB:1scuA	0.244	0.901	1.304E-17	288	0.087	0.333	1scuA.pdb.gz	The crystal structure of succinyl-CoA synthetase from Escherichia coli at 2.5-A resolution.
15	PDB:1eudB	0.293	0.737	3.146E-16	395	0.081	0.225	1eudB.pdb.gz
16	PDB:7jmkD	0.264	0.747	1.913E-14	354	0.076	0.237	7jmkD.pdb.gz	Second distinct conformation of the phosphohistidine loop in succinyl-CoA synthetase
17	PDB:3o8jA	0.184	0.521	5.892E-8	364	0.042	0.126	3o8jA.pdb.gz
18	PDB:6zu0C	0.170	0.401	1.563E-7	426	0.049	0.127	6zu0C.pdb.gz
19	PDB:1a59A	0.177	0.483	1.919E-7	377	0.044	0.127	1a59A.pdb.gz	Structural adaptations of the cold-active citrate synthase from an Antarctic bacterium.
20	PDB:3hwkE	0.176	0.497	1.919E-7	367	0.045	0.136	3hwkE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060W7T9	0.0	1955	1110	0.857	0.850	A0A060W7T9_ONCMY ATP-citrate synthase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00064821001 PE=3 SV=1
2	P16638	0.0	2231	1100	0.975	0.976	ACLY_RAT ATP-citrate synthase OS=Rattus norvegicus OX=10116 GN=Acly PE=1 SV=1
3	P53396	0.0	2282	1101	1.000	1.000	ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3
4	Q54YA0	0.0	693	622	0.298	0.527	ACLY_DICDI Probable ATP-citrate synthase OS=Dictyostelium discoideum OX=44689 GN=acly PE=1 SV=1
5	Q5BAJ4	0.0	885	655	0.366	0.615	Q5BAJ4_EMENI ATP citrate synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02436 PE=4 SV=1
6	Q7KN85	0.0	1619	1112	0.698	0.691	Q7KN85_DROME ATP-citrate synthase OS=Drosophila melanogaster OX=7227 GN=ATPCL PE=1 SV=1
7	Q91V92	0.0	2223	1091	0.972	0.981	ACLY_MOUSE ATP-citrate synthase OS=Mus musculus OX=10090 GN=Acly PE=1 SV=1
8	Q9C522	0.0	668	608	0.292	0.530	ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACLB-1 PE=2 SV=1
9	Q9FGX1	0.0	664	608	0.292	0.528	ACLB2_ARATH ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana OX=3702 GN=ACLB-2 PE=1 SV=1
10	Q9P7W3	0.0	868	615	0.361	0.646	ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1703.07 PE=1 SV=1
11	Q5BAJ5	2.16e-138	428	485	0.199	0.452	Q5BAJ5_EMENI ATP citrate synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02435 PE=4 SV=1
12	O13907	8.94e-137	424	492	0.214	0.480	ACL2_SCHPO Probable ATP-citrate synthase subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22A12.16 PE=1 SV=1
13	Q54YA2	6.19e-114	362	450	0.173	0.422	Q54YA2_DICDI ATP citrate synthase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278341 PE=4 SV=1
14	Q8KDG2	3.63e-112	363	610	0.197	0.356	Q8KDG2_CHLTE Citrate lyase, subunit2 OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1088 PE=4 SV=1
15	O22718	4.45e-110	351	423	0.172	0.447	ACLA2_ARATH ATP-citrate synthase alpha chain protein 2 OS=Arabidopsis thaliana OX=3702 GN=ACLA-2 PE=2 SV=1
16	F4I5V8	1.38e-106	343	443	0.162	0.402	F4I5V8_ARATH ATP citrate synthase OS=Arabidopsis thaliana OX=3702 GN=ACLA-1 PE=1 SV=1
17	O80526	9.17e-106	340	424	0.164	0.427	ACLA3_ARATH ATP-citrate synthase alpha chain protein 3 OS=Arabidopsis thaliana OX=3702 GN=ACLA-3 PE=2 SV=1
18	K7ESG8	6.77e-69	227	109	0.099	1.000	K7ESG8_HUMAN ATP citrate lyase (Fragment) OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=1
19	Q8KDG1	9.39e-45	169	398	0.119	0.329	Q8KDG1_CHLTE ATP citrate synthase OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1089 PE=3 SV=1
20	P0AGE9	2.02e-26	112	289	0.085	0.325	SUCD_ECOLI Succinate--CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=sucD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08442 ATP-grasp_2	0.16	23.1	ATP-grasp domain
2	PF16114 Citrate_bind	3.1e-87	302.2	ATP citrate lyase citrate-binding
3	PF00285 Citrate_synt	2e-19	81.5	Citrate synthase, C-terminal domain
4	PF02629 CoA_binding	1.4e-08	46.7	CoA binding domain
5	PF00549 Ligase_CoA	3.4e-10	51.4	CoA-ligase
6	PF13607 Succ_CoA_lig	3.7	18.8	Succinyl-CoA ligase like flavodoxin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304592	0.996	Fatty acid synthase
2	9606.ENSP00000342056	0.990	Citrate synthase, mitochondrial
3	9606.ENSP00000483300	0.987	Acetyl-CoA carboxylase 1
4	9606.ENSP00000216254	0.979	Aconitate hydratase, mitochondrial
5	9606.ENSP00000341044	0.978	Acetyl-CoA carboxylase 2
6	9606.ENSP00000280346	0.975	Dihydrolipoamide S-acetyltransferase
7	9606.ENSP00000377532	0.975	Pyruvate carboxylase, mitochondrial
8	9606.ENSP00000327070	0.973	Malate dehydrogenase, mitochondrial
9	9606.ENSP00000438144	0.967	Malate dehydrogenase, cytoplasmic
10	9606.ENSP00000320886	0.964	Carbohydrate-responsive element-binding protein
11	9606.ENSP00000309477	0.960	Cytoplasmic aconitate hydratase
12	9606.ENSP00000216780	0.951	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
13	9606.ENSP00000319814	0.951	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
14	9606.ENSP00000277865	0.923	Glutamate dehydrogenase 1, mitochondrial
15	9606.ENSP00000246912	0.918	Max-like protein X
16	9606.ENSP00000322706	0.918	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
17	9606.ENSP00000265838	0.896	Acetyl-CoA acetyltransferase, mitochondrial
18	9606.ENSP00000325136	0.891	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
19	9606.ENSP00000333664	0.891	3-ketoacyl-CoA thiolase, peroxisomal
20	9606.ENSP00000327589	0.886	Glutamate dehydrogenase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046912	0.996	acyltransferase activity, acyl groups converted into alkyl on transfer
GO:0005515	0.995	protein binding
GO:0003878	0.941	ATP citrate synthase activity
GO:0097159	0.907	organic cyclic compound binding
GO:0043167	0.898	ion binding
GO:1901363	0.894	heterocyclic compound binding
GO:0017076	0.878	purine nucleotide binding
GO:0032555	0.847	purine ribonucleotide binding
GO:0032559	0.823	adenyl ribonucleotide binding
GO:0005524	0.810	ATP binding
GO:0016829	0.321	lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006637	0.985	acyl-CoA metabolic process
GO:0006084	0.978	acetyl-CoA metabolic process
GO:0009058	0.965	biosynthetic process
GO:1901576	0.941	organic substance biosynthetic process
GO:0019752	0.934	carboxylic acid metabolic process
GO:0044249	0.914	cellular biosynthetic process
GO:0035384	0.895	thioester biosynthetic process
GO:0006629	0.868	lipid metabolic process
GO:0044283	0.843	small molecule biosynthetic process
GO:0090407	0.814	organophosphate biosynthetic process
GO:0034654	0.803	nucleobase-containing compound biosynthetic process
GO:0009152	0.790	purine ribonucleotide biosynthetic process
GO:0034030	0.785	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.785	purine nucleoside bisphosphate biosynthetic process
GO:0071616	0.782	acyl-CoA biosynthetic process
GO:0072350	0.765	tricarboxylic acid metabolic process
GO:0006085	0.706	acetyl-CoA biosynthetic process
GO:0008610	0.627	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.995	nucleoplasm
GO:0005739	0.882	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.3.-	0.996	Acyl groups converted into alkyl groups on transfer.
RHEA:21160	0.941	acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA
EC:2.3.3.8	0.941	ATP citrate synthase.
EC:4.-.-.-	0.321	Lyases.

[back to server]