StarFunc result for job id P53420

User Input

>input (1690 residues)
MWSLHIVLMRCSFRLTKSLATGPWSLILILFSVQYVYGSGKKYIGPCGGRDCSVCHCVPE
KGSRGPPGPPGPQGPIGPLGAPGPIGLSGEKGMRGDRGPPGAAGDKGDKGPTGVPGFPGL
DGIPGHPGPPGPRGKPGMSGHNGSRGDPGFPGGRGALGPGGPLGHPGEKGEKGNSVFILG
AVKGIQGDRGDPGLPGLPGSWGAGGPAGPTGYPGEPGLVGPPGQPGRPGLKGNPGVGVKG
QMGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMVGLPGPPGRKGESGIGAKGE
KGIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNRGHPGPPGVLVT
PPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPG
EAGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSVIYCSVGNPGPQGIKGKVGPPGGR
GPKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGL
PGKHGASGPPGNKGAKGDMVVSRVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGP
PGDHEDATPGGKGFPGPLGPPGKAGPVGPPGLGFPGPPGERGHPGVPGHPGVRGPDGLKG
QKGDTISCNVTYPGRHGPPGFDGPPGPKGFPGPQGAPGLSGSDGHKGRPGTPGTAEIPGP
PGFRGDMGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGPPGKRGLSGVPG
IKGPRGDPGCPGAEGPAGIPGFLGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPG
LPGYPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPG
PPGPKGPRGLPGFPGFPGERGKPGAEGCPGAKGEPGEKGMSGLPGDRGLRGAKGAIGPPG
DEGEMAIISQKGTPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGEPGEK
GQPGPPGPPGPPGSTGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGARGPKGNKGDPASH
FGPPGPKGEPGSPGCPGHFGASGEQGLPGIQGPRGSPGRPGPPGSSGPPGCPGDHGMPGL
RGQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPP
GPVGIPGLKGERGDPGSPGISPPGPRGKKGPPGPPGSSGPPGPAGATGRAPKDIPDPGPP
GDQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPPGYKGFPGCDGK
DGQKGPVGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGPRGEPGPPADVDDCPRIPG
LPGAPGMRGPEGAMGLPGMRGPSGPGCKGEPGLDGRRGVDGVPGSPGPPGRKGDTGEDGY
PGGPGPPGPIGDPGPKGFGPGYLGGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQE
KAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIR
PYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPG
SCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKI
SRCQVCVKYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53420	1.000	1.000	0.000	1690	1.000	1.000	P53420.pdb.gz	CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens OX=9606 GN=COL4A4 PE=1 SV=3
2	AFDB:Q9QZR9	0.183	0.183	0.000	1682	0.780	0.784	Q9QZR9.pdb.gz	CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus OX=10090 GN=Col4a4 PE=1 SV=1
3	AFDB:B1AVK5	0.145	0.145	1.107E-65	1691	0.502	0.501	B1AVK5.pdb.gz	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
4	AFDB:Q14031	0.145	0.145	3.166E-64	1691	0.500	0.500	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
5	AFDB:P08572	0.145	0.143	1.043E-61	1712	0.505	0.499	P08572.pdb.gz	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
6	AFDB:F1QYN1	0.170	0.168	1.070E-58	1714	0.492	0.485	F1QYN1.pdb.gz
7	AFDB:F1M6Q3	0.154	0.158	5.401E-57	1645	0.481	0.494	F1M6Q3.pdb.gz	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
8	AFDB:P17140	0.143	0.138	8.027E-55	1758	0.496	0.477	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
9	AFDB:Q63ZW6	0.164	0.164	1.935E-53	1691	0.500	0.500	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
10	AFDB:F1MA59	0.150	0.152	1.034E-51	1669	0.478	0.484	F1MA59.pdb.gz	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
11	PDB:4v96AS	0.020	0.066	5.542E-1	242	0.011	0.079	4v96AS.pdb.gz
12	PDB:5iv5A	0.030	0.058	9.784E-1	658	0.011	0.027	5iv5A.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
13	PDB:4fjcE	0.028	0.075	1.036	434	0.006	0.023	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:5k1bA	0.029	0.103	1.160	264	0.009	0.061	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:5lmxB	0.027	0.034	2.295	1115	0.009	0.014	5lmxB.pdb.gz	The dynamic assembly of distinct RNA polymerase I complexes modulates rDNA transcription.
16	PDB:6bzoB	0.017	0.062	3.827	237	0.007	0.046	6bzoB.pdb.gz	Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
17	PDB:6sh3A	0.024	0.077	4.539	376	0.005	0.024	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
18	PDB:7bvfA	0.025	0.035	4.539	1087	0.010	0.016	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
19	PDB:6ie2F	0.024	0.080	4.804	324	0.007	0.037	6ie2F.pdb.gz	Structural basis of nucleic acid recognition and 6mA demethylation by human ALKBH1.
20	PDB:6hv92	0.019	0.047	5.085	549	0.005	0.015	6hv92.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AHV3	0.0	726	1678	0.466	0.469	A0A8I6AHV3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
2	B1AVK5	0.0	891	1691	0.492	0.491	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
3	F1M6Q3	0.0	789	1707	0.485	0.480	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
4	F1RLL9	0.0	770	1712	0.489	0.483	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
5	O18407	0.0	630	1761	0.420	0.403	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
6	P02463	0.0	593	1669	0.466	0.472	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4
7	P08122	0.0	816	1707	0.494	0.489	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
8	P08572	0.0	628	1712	0.304	0.300	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
9	P17139	0.0	679	1759	0.445	0.428	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
10	P17140	0.0	596	1758	0.350	0.336	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
11	P53420	0.0	3026	1690	1.000	1.000	CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens OX=9606 GN=COL4A4 PE=1 SV=3
12	Q14031	0.0	866	1691	0.499	0.499	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
13	Q29442	0.0	568	453	0.215	0.801	CO4A4_BOVIN Collagen alpha-4(IV) chain (Fragment) OS=Bos taurus OX=9913 GN=COL4A4 PE=1 SV=1
14	Q9ESQ1	0.0	890	1691	0.492	0.491	Q9ESQ1_MOUSE Type IV collagen alpha 6 chain OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
15	Q9QZR9	0.0	1425	1682	0.782	0.785	CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus OX=10090 GN=Col4a4 PE=1 SV=1
16	Q9VMV5	0.0	642	1940	0.418	0.364	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
17	F1MA59	4.42e-179	586	1669	0.462	0.468	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
18	P02462	1.01e-157	527	1669	0.355	0.359	CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens OX=9606 GN=COL4A1 PE=1 SV=4
19	P08120	3.04e-136	468	1779	0.363	0.345	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
20	Q9QZS0	3.81e-132	454	1669	0.331	0.335	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01413 C4	1.1e-76	265.8	C-terminal tandem repeated domain in type 4 procollagen
2	PF01391 Collagen	2e-174	576.9	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379866

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452786	0.963	Integrin beta-3
2	9606.ENSP00000379823	0.949	Collagen alpha-3(IV) chain
3	9606.ENSP00000379350	0.936	Integrin beta-1
4	9606.ENSP00000282588	0.926	Integrin alpha-1
5	9606.ENSP00000364140	0.922	Collagen alpha-1(XV) chain
6	9606.ENSP00000261023	0.921	Integrin alpha-V
7	9606.ENSP00000331902	0.918	Collagen alpha-5(IV) chain
8	9606.ENSP00000364979	0.917	Collagen alpha-1(IV) chain
9	9606.ENSP00000296585	0.916	Integrin alpha-2
10	9606.ENSP00000353654	0.915	Collagen alpha-2(IV) chain
11	9606.ENSP00000378340	0.915	Collagen alpha-6(IV) chain
12	9606.ENSP00000263556	0.912	Prolyl 4-hydroxylase subunit alpha-1
13	9606.ENSP00000363973	0.906	Alkaline phosphatase, tissue-nonspecific isozyme
14	9606.ENSP00000384999	0.905	Prolyl 4-hydroxylase subunit alpha-2
15	9606.ENSP00000253496	0.903	Coagulation factor XII
16	9606.ENSP00000354238	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
17	9606.ENSP00000401749	0.902	Prolyl 4-hydroxylase subunit alpha-3
18	9606.ENSP00000370542	0.901	Syndecan-1
19	9606.ENSP00000226284	0.900	Bone sialoprotein 2
20	9606.ENSP00000351273	0.900	Caspase-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005201	1.000	extracellular matrix structural constituent
GO:0005488	0.995	binding
GO:0005515	0.994	protein binding
GO:0060090	0.901	molecular adaptor activity
GO:0030020	0.526	extracellular matrix structural constituent conferring tensile strength

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0032501	0.987	multicellular organismal process
GO:0032502	0.986	developmental process
GO:0048856	0.982	anatomical structure development
GO:0030198	0.929	extracellular matrix organization
GO:0007275	0.894	multicellular organism development
GO:0032835	0.846	glomerulus development
GO:0065007	0.793	biological regulation
GO:0050789	0.757	regulation of biological process
GO:0050794	0.648	regulation of cellular process
GO:0050896	0.614	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.989	extracellular region
GO:0005737	0.988	cytoplasm
GO:0012505	0.982	endomembrane system
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0099081	0.977	supramolecular polymer
GO:0098644	0.976	complex of collagen trimers
GO:0070013	0.976	intracellular organelle lumen
GO:0005587	0.970	collagen type IV trimer
GO:0005788	0.908	endoplasmic reticulum lumen
GO:0016020	0.593	membrane
GO:0005615	0.519	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]