StarFunc result for job id P53539

User Input

>input (338 residues)
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0P6	0.292	0.292	9.137E-43	338	1.000	1.000	A0A024R0P6.pdb.gz
2	AFDB:P01100	0.255	0.229	3.959E-12	380	0.479	0.426	P01100.pdb.gz	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
3	AFDB:A2RUX8	0.293	0.291	5.274E-12	341	0.411	0.408	A2RUX8.pdb.gz	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
4	AFDB:H0ZPP9	0.250	0.252	8.711E-12	335	0.423	0.427	H0ZPP9.pdb.gz	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
5	AFDB:F4JB53	0.195	0.154	7.449E-2	432	0.148	0.116	F4JB53.pdb.gz	F4JB53_ARATH ABRE binding factor 4 OS=Arabidopsis thaliana OX=3702 GN=ABF4 PE=1 SV=1
6	AFDB:F6YIV7	0.177	0.164	1.761E-1	366	0.192	0.178	F6YIV7.pdb.gz	F6YIV7_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=xbpd PE=1 SV=2
7	AFDB:A0A0F0IP79	0.199	0.210	2.520E-1	318	0.189	0.201	A0A0F0IP79.pdb.gz	ATFB_ASPPU Basic leucine zipper (bZIP) transcription factor atfB OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=atfB PE=1 SV=1
8	AFDB:Q9FFH0	0.092	0.085	2.707E-1	386	0.163	0.142	Q9FFH0.pdb.gz	GLK2_ARATH Transcription activator GLK2 OS=Arabidopsis thaliana OX=3702 GN=GLK2 PE=1 SV=1
9	AFDB:Q6PG16	0.074	0.045	4.472E-1	667	0.157	0.079	Q6PG16.pdb.gz	HJURP_MOUSE Holliday junction recognition protein OS=Mus musculus OX=10090 GN=Hjurp PE=1 SV=1
10	AFDB:P34807	0.095	0.079	5.545E-1	440	0.145	0.111	P34807.pdb.gz	DPY20_CAEEL Protein dumpy-20 OS=Caenorhabditis elegans OX=6239 GN=dpy-20 PE=2 SV=3
11	PDB:7mqaNB	0.064	0.190	7.821	103	0.027	0.087	7mqaNB.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53539	0.0	672	338	1.000	1.000	FOSB_HUMAN Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1
2	P13346	2.98e-166	468	338	0.959	0.959	FOSB_MOUSE Protein FosB OS=Mus musculus OX=10090 GN=Fosb PE=1 SV=1
3	D3ZLB7	1.22e-165	466	338	0.953	0.953	FOSB_RAT Protein FosB OS=Rattus norvegicus OX=10116 GN=Fosb PE=1 SV=1
4	Q6P0S4	3.59e-53	180	349	0.328	0.318	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
5	P01101	3.58e-51	176	380	0.506	0.450	FOS_MOUSE Protein c-Fos OS=Mus musculus OX=10090 GN=Fos PE=1 SV=1
6	P12841	7.25e-50	172	380	0.491	0.437	FOS_RAT Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1
7	H0ZPP9	1.75e-49	170	335	0.358	0.361	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
8	P01100	8.18e-48	167	380	0.488	0.434	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
9	Q6FG41	8.18e-48	167	380	0.488	0.434	Q6FG41_HUMAN FOS protein OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
10	A2RUX8	3.79e-45	159	341	0.355	0.352	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
11	P47930	2.73e-42	151	326	0.364	0.377	FOSL2_MOUSE Fos-related antigen 2 OS=Mus musculus OX=10090 GN=Fosl2 PE=1 SV=2
12	P51145	3.34e-42	150	326	0.364	0.377	FOSL2_RAT Fos-related antigen 2 OS=Rattus norvegicus OX=10116 GN=Fosl2 PE=1 SV=2
13	P15408	8.71e-42	150	326	0.358	0.371	FOSL2_HUMAN Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
14	C9JCN8	1.99e-38	137	202	0.320	0.535	C9JCN8_HUMAN FOS like 2, AP-1 transcription factor subunit (Fragment) OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
15	Q4H3J9	1.44e-28	117	501	0.154	0.104	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
16	P10158	7.75e-28	111	275	0.246	0.302	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
17	A0A0S2Z595	2.02e-26	107	271	0.240	0.299	A0A0S2Z595_HUMAN FOS-like antigen 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FOSL1 PE=2 SV=1
18	P15407	2.02e-26	107	271	0.240	0.299	FOSL1_HUMAN Fos-related antigen 1 OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
19	P48755	2.95e-24	102	273	0.237	0.293	FOSL1_MOUSE Fos-related antigen 1 OS=Mus musculus OX=10090 GN=Fosl1 PE=1 SV=2
20	A7S4U5	4.68e-18	83.2	205	0.124	0.205	A7S4U5_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g232694 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.00031	32.1	bZIP transcription factor
2	PF07716 bZIP_2	0.017	26.5	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.48	22.3	bZIP Maf transcription factor
4	PF04977 DivIC	1e+02	14.1	Septum formation initiator
5	PF11932 DUF3450	1.5e+02	13.1	Protein of unknown function (DUF3450)
6	PF14362 DUF4407	94	13.7	Domain of unknown function (DUF4407)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002506

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019981	0.973	Fos proto-oncogene, AP-1 transcription factor subunit
2	61853.ENSNLEP00000017965	0.951	Jun proto-oncogene, AP-1 transcription factor subunit
3	61853.ENSNLEP00000003167	0.928	Histone deacetylase 1
4	61853.ENSNLEP00000015855	0.895	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
5	61853.ENSNLEP00000007191	0.872	FOS like 1, AP-1 transcription factor subunit
6	61853.ENSNLEP00000010928	0.872	Early growth response protein
7	61853.ENSNLEP00000002660	0.861	Reticulon 2
8	61853.ENSNLEP00000014593	0.815	Sirtuin 1
9	61853.ENSNLEP00000018944	0.801	Mitogen-activated protein kinase 8
10	61853.ENSNLEP00000002611	0.798	Mitogen-activated protein kinase 9
11	61853.ENSNLEP00000011344	0.798	Mitogen-activated protein kinase 10
12	61853.ENSNLEP00000005013	0.783	Cyclin-dependent kinase 5
13	61853.ENSNLEP00000019239	0.780	Parvin, beta
14	61853.ENSNLEP00000000724	0.760	Mitogen-activated protein kinase 12
15	61853.ENSNLEP00000010857	0.760	Mitogen-activated protein kinase 14
16	61853.ENSNLEP00000010961	0.760	Mitogen-activated protein kinase 13
17	61853.ENSNLEP00000009135	0.758	MAF bZIP transcription factor G
18	61853.ENSNLEP00000014670	0.715	Early growth response 2
19	61853.ENSNLEP00000011508	0.692	Zinc finger Ran-binding domain-containing protein 2
20	61853.ENSNLEP00000021567	0.677	Nuclear receptor subfamily 4, group A, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000976	0.993	transcription cis-regulatory region binding
GO:0000981	0.988	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.974	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.959	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.952	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.548	transcription factor binding
GO:0042802	0.457	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0050896	0.991	response to stimulus
GO:0009987	0.987	cellular process
GO:0006357	0.985	regulation of transcription by RNA polymerase II
GO:0051716	0.983	cellular response to stimulus
GO:0042221	0.968	response to chemical
GO:0070887	0.954	cellular response to chemical stimulus
GO:0010033	0.875	response to organic substance
GO:0048522	0.847	positive regulation of cellular process
GO:0010604	0.833	positive regulation of macromolecule metabolic process
GO:1901700	0.773	response to oxygen-containing compound
GO:0051173	0.772	positive regulation of nitrogen compound metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0048519	0.770	negative regulation of biological process
GO:0010557	0.695	positive regulation of macromolecule biosynthetic process
GO:0031328	0.669	positive regulation of cellular biosynthetic process
GO:0045935	0.668	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.645	positive regulation of RNA metabolic process
GO:0045893	0.642	positive regulation of DNA-templated transcription
GO:1902074	0.585	response to salt
GO:0071704	0.579	organic substance metabolic process
GO:0044237	0.565	cellular metabolic process
GO:0048523	0.561	negative regulation of cellular process
GO:0044238	0.556	primary metabolic process
GO:0051172	0.532	negative regulation of nitrogen compound metabolic process
GO:0006807	0.527	nitrogen compound metabolic process
GO:0031324	0.517	negative regulation of cellular metabolic process
GO:0045944	0.479	positive regulation of transcription by RNA polymerase II
GO:0043170	0.466	macromolecule metabolic process
GO:0010605	0.459	negative regulation of macromolecule metabolic process
GO:0006950	0.457	response to stress
GO:0032501	0.359	multicellular organismal process
GO:0032502	0.355	developmental process
GO:0045934	0.326	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.323	negative regulation of cellular biosynthetic process
GO:0010558	0.318	negative regulation of macromolecule biosynthetic process
GO:0051253	0.317	negative regulation of RNA metabolic process
GO:0045892	0.310	negative regulation of DNA-templated transcription
GO:0007154	0.309	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.308	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]