StarFunc result for job id P53567

User Input

>input (150 residues)
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR
NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD
LFLEHAHNLADNVQSISTENTTADGDNAGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26801	0.595	0.595	4.218E-16	150	0.927	0.927	P26801.pdb.gz	CEBPG_RAT CCAAT/enhancer-binding protein gamma OS=Rattus norvegicus OX=10116 GN=Cebpg PE=1 SV=2
2	AFDB:F6WQK5	0.454	0.377	1.825E-4	182	0.387	0.319	F6WQK5.pdb.gz	F6WQK5_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=1
3	AFDB:E5Q8C6	0.447	0.200	3.849E-4	346	0.333	0.145	E5Q8C6.pdb.gz	E5Q8C6_PIG CCAAT/enhancer-binding protein OS=Sus scrofa OX=9823 GN=CEBPB PE=2 SV=1
4	AFDB:Q7ZU07	0.432	0.239	4.815E-4	280	0.287	0.154	Q7ZU07.pdb.gz	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
5	AFDB:Q90582	0.488	0.236	6.490E-4	324	0.293	0.136	Q90582.pdb.gz	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
6	AFDB:A5X2V8	0.468	0.229	1.712E-3	320	0.260	0.122	A5X2V8.pdb.gz	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:A5X2W0	0.441	0.221	1.712E-3	304	0.293	0.145	A5X2W0.pdb.gz	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
8	AFDB:A0A1D5NSQ7	0.376	0.341	3.892E-3	169	0.273	0.243	A0A1D5NSQ7.pdb.gz
9	AFDB:Q00322	0.451	0.261	4.869E-3	268	0.333	0.187	Q00322.pdb.gz	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2
10	AFDB:Q24217	0.401	0.270	8.209E-3	232	0.207	0.134	Q24217.pdb.gz	Q24217_DROME PAR domain protein 1-delta OS=Drosophila melanogaster OX=7227 GN=Pdp1 PE=2 SV=2
11	PDB:7mqaNA	0.213	0.112	8.062	295	0.120	0.061	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53567	9.77e-108	305	150	1.000	1.000	CEBPG_HUMAN CCAAT/enhancer-binding protein gamma OS=Homo sapiens OX=9606 GN=CEBPG PE=1 SV=1
2	P26801	1.23e-84	246	150	0.927	0.927	CEBPG_RAT CCAAT/enhancer-binding protein gamma OS=Rattus norvegicus OX=10116 GN=Cebpg PE=1 SV=2
3	P53568	1.98e-83	243	150	0.913	0.913	CEBPG_MOUSE CCAAT/enhancer-binding protein gamma OS=Mus musculus OX=10090 GN=Cebpg PE=1 SV=1
4	Q54AJ1	1.98e-83	243	150	0.913	0.913	Q54AJ1_MOUSE GPE1-BP OS=Mus musculus OX=10090 GN=Cebpg PE=1 SV=1
5	F6WQK5	2.09e-24	94.7	182	0.340	0.280	F6WQK5_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=1
6	A7S4U3	9.56e-22	84.7	66	0.267	0.606	A7S4U3_NEMVE BZIP domain-containing protein (Fragment) OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g104726 PE=1 SV=1
7	Q05826	8.43e-18	80.1	328	0.260	0.119	CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus OX=9031 GN=CEBPB PE=1 SV=1
8	P17676	9.59e-17	77.4	345	0.273	0.119	CEBPB_HUMAN CCAAT/enhancer-binding protein beta OS=Homo sapiens OX=9606 GN=CEBPB PE=1 SV=2
9	A7SDE7	1.04e-16	71.6	61	0.247	0.607	A7SDE7_NEMVE BZIP domain-containing protein (Fragment) OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g114346 PE=1 SV=1
10	Q7ZU07	2.12e-16	75.9	280	0.253	0.136	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
11	Q8IG69	6.26e-16	70.5	100	0.227	0.340	CEBP2_CAEEL CCAAT/enhancer-binding protein homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cebp-2 PE=1 SV=1
12	Q90582	6.76e-16	74.7	324	0.260	0.120	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
13	Q03484	1.62e-15	73.2	268	0.267	0.149	CEBPD_RAT CCAAT/enhancer-binding protein delta OS=Rattus norvegicus OX=10116 GN=Cebpd PE=2 SV=1
14	P49715	2.42e-15	73.6	358	0.280	0.117	CEBPA_HUMAN CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3
15	Q7SZH5	3.40e-15	72.8	291	0.247	0.127	Q7SZH5_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=C/EBPbeta PE=2 SV=1
16	Q00322	4.57e-15	72.0	268	0.260	0.146	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2
17	E5Q8C6	4.89e-15	72.8	346	0.240	0.104	E5Q8C6_PIG CCAAT/enhancer-binding protein OS=Sus scrofa OX=9823 GN=CEBPB PE=2 SV=1
18	P49716	6.61e-15	71.6	269	0.233	0.130	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
19	O97894	8.00e-15	67.0	69	0.227	0.493	O97894_PIG CCAAT/enhancer binding protein beta (Fragment) OS=Sus scrofa OX=9823 GN=C/EBP beta PE=2 SV=1
20	P56261	8.89e-15	71.2	281	0.267	0.142	CEBPE_RAT CCAAT/enhancer-binding protein epsilon OS=Rattus norvegicus OX=10116 GN=Cebpe PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.0077	27.6	bZIP transcription factor
2	PF07716 bZIP_2	1.1e-11	55.9	Basic region leucine zipper
3	PF14197 Cep57_CLD_2	2.6e+02	13.1	Centrosome localisation domain of PPC89
4	PF04977 DivIC	7.1e+02	11.4	Septum formation initiator
5	PF07028 DUF1319	1.3e+02	14.2	Protein of unknown function (DUF1319)
6	PF02403 Seryl_tRNA_N	3e+02	13.1	Seryl-tRNA synthetase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448665	0.967	DNA damage-inducible transcript 3 protein
2	9606.ENSP00000396954	0.954	Cyclic AMP-dependent transcription factor ATF-5
3	9606.ENSP00000336790	0.948	Cyclic AMP-dependent transcription factor ATF-4
4	9606.ENSP00000217233	0.929	Tribbles homolog 3
5	9606.ENSP00000175506	0.925	Asparagine synthetase
6	9606.ENSP00000306245	0.920	Proto-oncogene c-Fos
7	9606.ENSP00000305422	0.912	CCAAT/enhancer-binding protein beta
8	9606.ENSP00000485010	0.800	MHC class II transactivator
9	9606.ENSP00000162044	0.719	Transmembrane protein 161A
10	9606.ENSP00000064778	0.707	Protein FAM168A
11	9606.ENSP00000264110	0.707	Cyclic AMP-dependent transcription factor ATF-2
12	9606.ENSP00000344352	0.686	Cyclic AMP-dependent transcription factor ATF-3
13	9606.ENSP00000450607	0.679	Protein timeless homolog
14	9606.ENSP00000256383	0.676	Eukaryotic translation initiation factor 2 subunit 1
15	9606.ENSP00000387699	0.665	Cyclic AMP-responsive element-binding protein 1
16	9606.ENSP00000278572	0.661	40S ribosomal protein S3
17	9606.ENSP00000356211	0.660	Transmembrane protein 183A
18	9606.ENSP00000354425	0.652	E3 ubiquitin-protein ligase Jade-2
19	9606.ENSP00000253039	0.650	Eukaryotic translation initiation factor 2 subunit 3
20	9606.ENSP00000364119	0.650	Eukaryotic translation initiation factor 2 subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.958	transcription regulator activity
GO:0003700	0.952	DNA-binding transcription factor activity
GO:0000981	0.934	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.779	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008301	0.669	DNA binding, bending
GO:0044877	0.617	protein-containing complex binding
GO:0140297	0.374	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0010468	0.996	regulation of gene expression
GO:0019219	0.989	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0048518	0.981	positive regulation of biological process
GO:0010604	0.964	positive regulation of macromolecule metabolic process
GO:0009987	0.906	cellular process
GO:0006357	0.893	regulation of transcription by RNA polymerase II
GO:0048522	0.890	positive regulation of cellular process
GO:0050896	0.865	response to stimulus
GO:0045935	0.865	positive regulation of nucleobase-containing compound metabolic process
GO:0032502	0.785	developmental process
GO:0051254	0.753	positive regulation of RNA metabolic process
GO:1903508	0.715	positive regulation of nucleic acid-templated transcription
GO:0045893	0.713	positive regulation of DNA-templated transcription
GO:0048519	0.699	negative regulation of biological process
GO:0071704	0.616	organic substance metabolic process
GO:0051716	0.596	cellular response to stimulus
GO:0032501	0.590	multicellular organismal process
GO:0048523	0.588	negative regulation of cellular process
GO:0006950	0.573	response to stress
GO:0045944	0.570	positive regulation of transcription by RNA polymerase II
GO:0048856	0.558	anatomical structure development
GO:0044238	0.537	primary metabolic process
GO:0044237	0.510	cellular metabolic process
GO:0006807	0.483	nitrogen compound metabolic process
GO:0048583	0.460	regulation of response to stimulus
GO:0043170	0.410	macromolecule metabolic process
GO:0009892	0.381	negative regulation of metabolic process
GO:0010605	0.362	negative regulation of macromolecule metabolic process
GO:0051172	0.344	negative regulation of nitrogen compound metabolic process
GO:0048584	0.314	positive regulation of response to stimulus
GO:0080134	0.312	regulation of response to stress
GO:0031324	0.300	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0140513	0.952	nuclear protein-containing complex
GO:0090575	0.944	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]