StarFunc result for job id P53597

User Input

>input (346 residues)
MTATLAAAADIATMVSGSSGLAAARLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIIC
QGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYV
PPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGE
CKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFIDCL
EIFLNDSATEGIILIGEIGGNAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHA
GAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O19069	0.943	0.943	6.276E-70	346	0.945	0.945	O19069.pdb.gz	SUCA_PIG Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Sus scrofa OX=9823 GN=SUCLG1 PE=1 SV=2
2	AFDB:Q94522	0.882	0.930	3.195E-56	328	0.642	0.677	Q94522.pdb.gz	SUCA_DROME Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Scsalpha1 PE=2 SV=3
3	AFDB:P53596	0.874	0.939	1.434E-54	322	0.618	0.665	P53596.pdb.gz	SUCA_CAEEL Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sucl-1 PE=3 SV=1
4	AFDB:P36967	0.842	0.924	1.218E-53	315	0.647	0.711	P36967.pdb.gz	SUCA_DICDI Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=scsA PE=1 SV=3
5	AFDB:Q6DQL1	0.847	0.870	7.246E-53	337	0.633	0.650	Q6DQL1.pdb.gz	SUCA2_SOLLC Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Solanum lycopersicum OX=4081 PE=1 SV=1
6	AFDB:P68209	0.857	0.855	1.665E-52	347	0.627	0.625	P68209.pdb.gz	SUCA1_ARATH Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08300 PE=1 SV=1
7	AFDB:O13750	0.875	0.915	1.256E-51	331	0.592	0.619	O13750.pdb.gz	SUCA_SCHPO Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16E8.17c PE=3 SV=1
8	AFDB:Q582T6	0.855	0.982	6.636E-51	301	0.578	0.664	Q582T6.pdb.gz	Q582T6_TRYB2 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.710 PE=3 SV=1
9	AFDB:P53598	0.863	0.907	1.205E-46	329	0.529	0.556	P53598.pdb.gz	SUCA_YEAST Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSC1 PE=1 SV=1
10	AFDB:P0AGE9	0.813	0.972	1.440E-46	289	0.555	0.664	P0AGE9.pdb.gz	SUCD_ECOLI Succinate--CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=sucD PE=1 SV=2
11	PDB:1scuA	0.810	0.972	4.767E-41	288	0.555	0.667	1scuA.pdb.gz	The crystal structure of succinyl-CoA synthetase from Escherichia coli at 2.5-A resolution.
12	PDB:6qfbB	0.729	0.256	4.835E-17	1035	0.240	0.080	6qfbB.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
13	PDB:6qfbC	0.714	0.257	1.179E-16	1011	0.220	0.075	6qfbC.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
14	PDB:1eudB	0.305	0.270	2.896E-4	395	0.049	0.043	1eudB.pdb.gz
15	PDB:7jmkD	0.314	0.307	3.461E-4	354	0.046	0.045	7jmkD.pdb.gz	Second distinct conformation of the phosphohistidine loop in succinyl-CoA synthetase
16	PDB:1ultA	0.231	0.167	1.280E-3	533	0.139	0.090	1ultA.pdb.gz
17	PDB:3gwgA	0.254	0.602	1.358E-3	123	0.055	0.154	3gwgA.pdb.gz	Crystal structure of activated CheY1 from Helicobacter pylori.
18	PDB:1rpnD	0.205	0.218	2.941E-3	322	0.104	0.112	1rpnD.pdb.gz	Crystal structure of a tetrameric GDP-D-mannose 4,6-dehydratase from a bacterial GDP-D-rhamnose biosynthetic pathway.
19	PDB:5hj7B	0.164	0.203	3.121E-3	260	0.092	0.123	5hj7B.pdb.gz	Exploring the structure of glutamate racemase from Mycobacterium tuberculosis as a template for anti-mycobacterial drug discovery.
20	PDB:6hcyC	0.239	0.195	3.515E-3	436	0.061	0.048	6hcyC.pdb.gz	Cryo-EM structures of human STEAP4 reveal mechanism of iron(III) reduction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O19069	0.0	576	346	0.945	0.945	SUCA_PIG Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Sus scrofa OX=9823 GN=SUCLG1 PE=1 SV=2
2	P13086	0.0	573	346	0.870	0.870	SUCA_RAT Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg1 PE=2 SV=2
3	P53597	0.0	702	346	1.000	1.000	SUCA_HUMAN Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4
4	Q9WUM5	0.0	580	346	0.890	0.890	SUCA_MOUSE Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Suclg1 PE=1 SV=4
5	Q8GTQ9	7.61e-157	444	332	0.613	0.639	SUCA1_SOLLC Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Solanum lycopersicum OX=4081 GN=SCOA PE=1 SV=1
6	P68209	2.11e-154	439	347	0.610	0.608	SUCA1_ARATH Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08300 PE=1 SV=1
7	Q8LAD2	9.68e-153	434	341	0.604	0.613	SUCA2_ARATH Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g23250 PE=1 SV=2
8	P53596	2.97e-150	427	322	0.618	0.665	SUCA_CAEEL Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sucl-1 PE=3 SV=1
9	Q6DQL1	3.18e-148	423	337	0.618	0.635	SUCA2_SOLLC Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Solanum lycopersicum OX=4081 PE=1 SV=1
10	P36967	4.21e-147	419	315	0.647	0.711	SUCA_DICDI Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=scsA PE=1 SV=3
11	Q94522	7.67e-147	419	328	0.630	0.665	SUCA_DROME Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Scsalpha1 PE=2 SV=3
12	P0AGE9	7.15e-134	384	289	0.555	0.664	SUCD_ECOLI Succinate--CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=sucD PE=1 SV=2
13	Q51567	7.48e-131	377	295	0.552	0.647	SUCD_PSEAE Succinate--CoA ligase [ADP-forming] subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=sucD PE=1 SV=2
14	Q582T6	1.13e-129	374	301	0.581	0.668	Q582T6_TRYB2 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.710 PE=3 SV=1
15	O13750	1.30e-126	368	331	0.575	0.601	SUCA_SCHPO Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16E8.17c PE=3 SV=1
16	P53598	8.94e-122	355	329	0.526	0.553	SUCA_YEAST Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSC1 PE=1 SV=1
17	P9WGC7	8.79e-86	263	303	0.413	0.472	SUCD_MYCTU Succinate--CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sucD PE=1 SV=1
18	Q8KDG2	8.73e-30	122	610	0.251	0.143	Q8KDG2_CHLTE Citrate lyase, subunit2 OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1088 PE=4 SV=1
19	Q54YA0	2.69e-18	88.2	622	0.234	0.130	ACLY_DICDI Probable ATP-citrate synthase OS=Dictyostelium discoideum OX=44689 GN=acly PE=1 SV=1
20	Q9C522	2.85e-18	88.2	608	0.202	0.115	ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACLB-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02629 CoA_binding	3.8e-29	112.6	CoA binding domain
2	PF13380 CoA_binding_2	0.37	22.7	CoA binding domain
3	PF00549 Ligase_CoA	7.1e-20	82.9	CoA-ligase
4	PF13607 Succ_CoA_lig	3.4e-05	35.1	Succinyl-CoA ligase like flavodoxin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364649	0.999	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
2	9606.ENSP00000367923	0.999	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
3	9606.ENSP00000419325	0.999	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
4	9606.ENSP00000335304	0.997	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
5	9606.ENSP00000264932	0.996	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
6	9606.ENSP00000356953	0.991	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
7	9606.ENSP00000222673	0.985	2-oxoglutarate dehydrogenase, mitochondrial
8	9606.ENSP00000280346	0.985	Dihydrolipoamide S-acetyltransferase
9	9606.ENSP00000364699	0.979	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
10	9606.ENSP00000217901	0.977	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
11	9606.ENSP00000342056	0.976	Citrate synthase, mitochondrial
12	9606.ENSP00000370223	0.976	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
13	9606.ENSP00000327070	0.971	Malate dehydrogenase, mitochondrial
14	9606.ENSP00000355518	0.966	Fumarate hydratase, mitochondrial
15	9606.ENSP00000307241	0.964	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
16	9606.ENSP00000299518	0.963	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
17	9606.ENSP00000216254	0.959	Aconitate hydratase, mitochondrial
18	9606.ENSP00000349142	0.954	ATP synthase subunit gamma, mitochondrial
19	9606.ENSP00000262030	0.953	ATP synthase subunit beta, mitochondrial
20	9606.ENSP00000274813	0.952	Methylmalonyl-CoA mutase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003824	0.985	catalytic activity
GO:0004774	0.895	succinate-CoA ligase activity
GO:0097159	0.477	organic cyclic compound binding
GO:1901363	0.458	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006637	0.998	acyl-CoA metabolic process
GO:0043648	0.985	dicarboxylic acid metabolic process
GO:0006091	0.977	generation of precursor metabolites and energy
GO:0015980	0.965	energy derivation by oxidation of organic compounds
GO:0009060	0.957	aerobic respiration
GO:0006099	0.809	tricarboxylic acid cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0032991	0.983	protein-containing complex
GO:0005759	0.923	mitochondrial matrix
GO:0098798	0.906	mitochondrial protein-containing complex
GO:0016020	0.871	membrane
GO:1902494	0.842	catalytic complex
GO:0045239	0.392	tricarboxylic acid cycle enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	0.895	Acid--thiol ligases.

[back to server]