StarFunc result for job id P53621

User Input

>input (1224 residues)
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAG
GAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5a1vK	0.361	0.385	0.000	1126	0.904	0.983	5a1vK.pdb.gz
2	AFDB:O77285	0.750	0.745	0.000	1234	0.711	0.705	O77285.pdb.gz	O77285_DROME Coatomer subunit alpha OS=Drosophila melanogaster OX=7227 GN=alphaCOP PE=2 SV=1
3	AFDB:P53621	1.000	1.000	0.000	1224	1.000	1.000	P53621.pdb.gz	COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2
4	AFDB:P53622	0.572	0.582	0.000	1201	0.433	0.441	P53622.pdb.gz	COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COP1 PE=1 SV=2
5	AFDB:Q6JWU9	0.658	0.657	0.000	1226	0.864	0.863	Q6JWU9.pdb.gz
6	AFDB:Q96WV5	0.592	0.599	0.000	1207	0.466	0.472	Q96WV5.pdb.gz	COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPJ4664.04 PE=1 SV=1
7	AFDB:Q9SJT9	0.646	0.649	0.000	1218	0.546	0.548	Q9SJT9.pdb.gz	COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=At2g21390 PE=2 SV=1
8	AFDB:A0A286Y8Z3	0.264	0.594	4.692E-53	538	0.364	0.829	A0A286Y8Z3.pdb.gz
9	AFDB:A0A2R8RUW2	0.419	0.501	2.241E-51	981	0.188	0.234	A0A2R8RUW2.pdb.gz
10	AFDB:Q9CAA0	0.377	0.483	3.820E-51	920	0.185	0.246	Q9CAA0.pdb.gz	COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana OX=3702 GN=At1g79990 PE=2 SV=2
11	AFDB:F4J1E5	0.445	0.559	8.887E-51	930	0.180	0.237	F4J1E5.pdb.gz	F4J1E5_ARATH Coatomer subunit beta' OS=Arabidopsis thaliana OX=3702 GN=At3g15980 PE=1 SV=1
12	PDB:5nzrC	0.447	0.606	5.947E-39	843	0.171	0.248	5nzrC.pdb.gz
13	PDB:7mq8LR	0.239	0.310	9.263E-23	773	0.092	0.146	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ajuUL	0.241	0.348	1.382E-22	779	0.091	0.142	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mqaLQ	0.216	0.293	2.253E-22	830	0.091	0.134	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:3sfzA	0.230	0.247	3.215E-22	1133	0.069	0.075	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
17	PDB:7d5sB2	0.243	0.327	1.469E-20	851	0.091	0.130	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:6lqsB1	0.217	0.322	1.618E-19	806	0.094	0.143	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
19	PDB:7mq8LT	0.208	0.269	3.295E-19	869	0.059	0.083	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7mqaLO	0.226	0.301	3.602E-19	819	0.087	0.131	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O77285	0.0	1783	1234	0.705	0.699	O77285_DROME Coatomer subunit alpha OS=Drosophila melanogaster OX=7227 GN=alphaCOP PE=2 SV=1
2	P53621	0.0	2556	1224	1.000	1.000	COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2
3	P53622	0.0	1049	1201	0.444	0.452	COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COP1 PE=1 SV=2
4	Q27954	0.0	2536	1224	0.989	0.989	COPA_BOVIN Coatomer subunit alpha OS=Bos taurus OX=9913 GN=COPA PE=1 SV=1
5	Q5F354	0.0	2486	1224	0.966	0.966	Q5F354_CHICK Coatomer subunit alpha OS=Gallus gallus OX=9031 GN=RCJMB04_34d13 PE=2 SV=1
6	Q6DRK5	0.0	2266	1224	0.866	0.866	Q6DRK5_DANRE Coatomer subunit alpha OS=Danio rerio OX=7955 GN=wu:fb13c12 PE=1 SV=1
7	Q8CIE6	0.0	2524	1224	0.984	0.984	COPA_MOUSE Coatomer subunit alpha OS=Mus musculus OX=10090 GN=Copa PE=1 SV=2
8	Q94A40	0.0	1380	1216	0.556	0.559	COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=At1g62020 PE=2 SV=2
9	Q96WV5	0.0	1140	1207	0.473	0.480	COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPJ4664.04 PE=1 SV=1
10	Q9SJT9	0.0	1359	1218	0.556	0.558	COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=At2g21390 PE=2 SV=1
11	Q9W0B8	0.0	1790	1234	0.707	0.701	Q9W0B8_DROME Coatomer subunit alpha OS=Drosophila melanogaster OX=7227 GN=alphaCOP PE=1 SV=1
12	O55029	7.55e-78	278	905	0.176	0.239	COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus OX=10090 GN=Copb2 PE=1 SV=2
13	P35606	1.35e-77	278	906	0.177	0.240	COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2
14	P35605	1.54e-77	277	906	0.176	0.238	COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus OX=9913 GN=COPB2 PE=1 SV=3
15	O35142	3.10e-77	276	905	0.176	0.239	COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus OX=10116 GN=Copb2 PE=1 SV=3
16	Q6JWU7	1.21e-76	275	934	0.169	0.222	Q6JWU7_DANRE Coatomer subunit beta' OS=Danio rerio OX=7955 GN=sb:cb121 PE=1 SV=1
17	Q20168	3.05e-74	270	1000	0.174	0.213	COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans OX=6239 GN=copb-2 PE=3 SV=3
18	O62621	2.84e-71	259	914	0.171	0.229	COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster OX=7227 GN=beta'COP PE=2 SV=2
19	O42937	2.86e-71	257	796	0.182	0.280	COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec27 PE=3 SV=2
20	P41811	2.78e-65	241	889	0.172	0.237	COPB2_YEAST Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.3e-05	35.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF04053 Coatomer_WDAD	8.4e-140	478.4	Coatomer WD associated region
3	PF06957 COPI_C	3.1e-179	607.5	Coatomer (COPI) alpha subunit C-terminus
4	PF20426 NBCH_WD40	1.4	19.3	Neurobeachin beta propeller domain
5	PF11715 Nup160	8.3e+02	10.1	Nucleoporin Nup120/160
6	PF13428 TPR_14	8	18.5	Tetratricopeptide repeat
7	PF00400 WD40	1.1e-36	135.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003811927.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003818236.1	0.998	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
2	9597.XP_003826587.1	0.998	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
3	9597.XP_003820087.1	0.997	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
4	9597.XP_003817791.1	0.996	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
5	9597.XP_003829466.1	0.995	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
6	9597.XP_003813516.2	0.988	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
7	9597.XP_008957967.1	0.988	The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
8	9597.XP_008951307.1	0.959	The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
9	9597.XP_008949086.1	0.956	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 isoform X1
10	9597.XP_008966674.1	0.877	ADP ribosylation factor GTPase activating protein 3
11	9597.XP_008960513.1	0.855	ADP ribosylation factor GTPase activating protein 1
12	9597.XP_008966371.1	0.848	ADP ribosylation factor GTPase activating protein 2
13	9597.XP_008949997.1	0.818	STT3B, catalytic subunit of the oligosaccharyltransferase complex
14	9597.XP_008958574.1	0.789	Belongs to the PAL/histidase family.
15	9597.XP_003833453.1	0.786	Minor histocompatibility antigen H13 isoform X1
16	9597.XP_003813029.1	0.785	SEC24 homolog C, COPII coat complex component
17	9597.XP_008953676.1	0.785	SEC24 homolog D, COPII coat complex component
18	9597.XP_003824227.1	0.783	Transmembrane p24 trafficking protein 10
19	9597.XP_003814140.1	0.772	KDEL endoplasmic reticulum protein retention receptor 1
20	9597.XP_008956666.1	0.772	KDEL endoplasmic reticulum protein retention receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.994	localization
GO:0006810	0.948	transport
GO:0009987	0.926	cellular process
GO:0016192	0.867	vesicle-mediated transport
GO:0033036	0.858	macromolecule localization
GO:0051641	0.858	cellular localization
GO:0048193	0.832	Golgi vesicle transport
GO:0008104	0.769	protein localization
GO:0065007	0.731	biological regulation
GO:0032501	0.591	multicellular organismal process
GO:0015031	0.466	protein transport
GO:0046907	0.456	intracellular transport
GO:0032502	0.427	developmental process
GO:0050789	0.364	regulation of biological process
GO:0048856	0.354	anatomical structure development
GO:0071840	0.320	cellular component organization or biogenesis
GO:0016043	0.302	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.998	membrane
GO:0032991	0.997	protein-containing complex
GO:0031982	0.995	vesicle
GO:0031410	0.993	cytoplasmic vesicle
GO:0098588	0.991	bounding membrane of organelle
GO:0098796	0.985	membrane protein complex
GO:0012506	0.985	vesicle membrane
GO:0030137	0.984	COPI-coated vesicle
GO:0030660	0.982	Golgi-associated vesicle membrane
GO:0030120	0.978	vesicle coat
GO:0030126	0.972	COPI vesicle coat
GO:0042995	0.899	cell projection
GO:0120025	0.865	plasma membrane bounded cell projection
GO:0030427	0.862	site of polarized growth
GO:0150034	0.857	distal axon
GO:0030426	0.786	growth cone
GO:0000139	0.401	Golgi membrane
GO:0005634	0.303	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]