StarFunc result for job id P53667

User Input

>input (647 residues)
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PC47	0.504	0.486	0.000	677	0.977	0.934	E9PC47.pdb.gz	E9PC47_HUMAN LIM domain kinase 1 OS=Homo sapiens OX=9606 GN=LIMK1 PE=1 SV=1
2	AFDB:B3DIV5	0.474	0.473	7.665E-96	648	0.731	0.730	B3DIV5.pdb.gz
3	AFDB:O54785	0.460	0.466	5.648E-78	638	0.526	0.533	O54785.pdb.gz	LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus OX=10090 GN=Limk2 PE=1 SV=2
4	AFDB:E1JJM7	0.439	0.238	2.736E-68	1235	0.454	0.238	E1JJM7.pdb.gz	E1JJM7_DROME LIM domain kinase 1, isoform E OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=3 SV=1
5	AFDB:Q9VE06	0.381	0.207	1.583E-30	1213	0.182	0.097	Q9VE06.pdb.gz	Q9VE06_DROME Center divider, isoform A OS=Drosophila melanogaster OX=7227 GN=cdi PE=2 SV=1
6	AFDB:Q63572	0.404	0.416	1.208E-29	628	0.212	0.218	Q63572.pdb.gz	TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Tesk1 PE=1 SV=1
7	AFDB:Q05609	0.360	0.288	1.311E-23	821	0.193	0.152	Q05609.pdb.gz	CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1
8	AFDB:Q9LFH9	0.363	0.330	5.175E-23	715	0.168	0.152	Q9LFH9.pdb.gz	LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana OX=3702 GN=LECRK81 PE=2 SV=1
9	AFDB:A0A178UNT9	0.362	0.440	1.180E-22	525	0.156	0.192	A0A178UNT9.pdb.gz	A0A178UNT9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At5g58950 PE=1 SV=1
10	AFDB:Q9ZQ31	0.344	0.531	2.280E-22	411	0.170	0.268	Q9ZQ31.pdb.gz	STY13_ARATH Serine/threonine-protein kinase STY13 OS=Arabidopsis thaliana OX=3702 GN=STY13 PE=1 SV=2
11	PDB:8dksA	0.333	0.730	1.740E-19	283	0.110	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:1k9aB	0.339	0.489	7.669E-19	441	0.124	0.181	1k9aB.pdb.gz
13	PDB:2qkwB	0.352	0.742	9.042E-19	292	0.116	0.257	2qkwB.pdb.gz
14	PDB:2h8hA	0.335	0.475	2.061E-18	445	0.142	0.207	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:5u6yA	0.337	0.466	1.014E-17	459	0.097	0.137	5u6yA.pdb.gz
16	PDB:4rerA	0.321	0.444	2.441E-17	459	0.127	0.179	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:4eomC	0.343	0.772	3.041E-17	276	0.105	0.246	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:4zhxA	0.340	0.525	4.719E-17	409	0.110	0.174	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:5ufuA	0.339	0.576	4.985E-17	369	0.110	0.192	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:6b1uA	0.326	0.466	5.879E-17	442	0.113	0.165	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PC47	0.0	1303	677	0.972	0.929	E9PC47_HUMAN LIM domain kinase 1 OS=Homo sapiens OX=9606 GN=LIMK1 PE=1 SV=1
2	O54785	0.0	670	638	0.527	0.534	LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus OX=10090 GN=Limk2 PE=1 SV=2
3	P53667	0.0	1339	647	1.000	1.000	LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens OX=9606 GN=LIMK1 PE=1 SV=3
4	P53668	0.0	1283	647	0.952	0.952	LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus OX=10090 GN=Limk1 PE=1 SV=1
5	P53669	0.0	1281	647	0.952	0.952	LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus OX=10116 GN=Limk1 PE=1 SV=1
6	P53670	0.0	672	638	0.527	0.534	LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus OX=10116 GN=Limk2 PE=2 SV=1
7	P53671	0.0	671	638	0.527	0.534	LIMK2_HUMAN LIM domain kinase 2 OS=Homo sapiens OX=9606 GN=LIMK2 PE=1 SV=1
8	Q0PWB7	0.0	925	648	0.725	0.724	Q0PWB7_DANRE LIM domain kinase 1 OS=Danio rerio OX=7955 GN=limk1 PE=2 SV=1
9	E1JJM7	3.12e-175	533	1235	0.471	0.247	E1JJM7_DROME LIM domain kinase 1, isoform E OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=3 SV=1
10	Q8IR79	1.43e-172	527	1257	0.476	0.245	LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=1 SV=1
11	E1JJM8	2.29e-126	400	1043	0.352	0.219	E1JJM8_DROME LIM domain kinase 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LIMK1 PE=4 SV=1
12	Q96S53	1.49e-67	233	571	0.185	0.210	TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens OX=9606 GN=TESK2 PE=1 SV=1
13	Q924U5	5.00e-66	229	570	0.193	0.219	TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Tesk2 PE=2 SV=1
14	Q63572	1.23e-64	226	628	0.190	0.196	TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Tesk1 PE=1 SV=1
15	Q15569	1.48e-64	226	626	0.193	0.200	TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens OX=9606 GN=TESK1 PE=1 SV=2
16	O70146	9.87e-64	224	627	0.189	0.195	TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus OX=10090 GN=Tesk1 PE=1 SV=3
17	Q9VE06	4.99e-56	208	1213	0.162	0.087	Q9VE06_DROME Center divider, isoform A OS=Drosophila melanogaster OX=7227 GN=cdi PE=2 SV=1
18	Q9M085	5.07e-42	159	412	0.155	0.243	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
19	Q9ZQ31	1.10e-39	152	411	0.155	0.243	STY13_ARATH Serine/threonine-protein kinase STY13 OS=Arabidopsis thaliana OX=3702 GN=STY13 PE=1 SV=2
20	P09760	4.00e-34	141	823	0.139	0.109	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	37	14.9	ABC1 atypical kinase-like domain
2	PF01636 APH	4.7	18.6	Phosphotransferase enzyme family
3	PF12330 Haspin_kinase	62	14.0	Haspin like kinase domain
4	PF06293 Kdo	0.0037	28.2	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF00412 LIM	2.5e-26	103.0	LIM domain
6	PF00595 PDZ	4.6e-11	54.2	PDZ domain
7	PF13180 PDZ_2	1.7e+02	14.0	PDZ domain
8	PF17816 PDZ_4	6.9e+02	11.9	PDZ domain
9	PF17820 PDZ_6	2.7	19.3	PDZ domain
10	PF00069 Pkinase	3.7e-45	165.9	Protein kinase domain
11	PF17667 Pkinase_fungal	2.2e+02	12.0	Fungal protein kinase
12	PF16918 PknG_TPR	9.4e+02	10.0	Protein kinase G tetratricopeptide repeat
13	PF07714 PK_Tyr_Ser-Thr	3.6e-51	185.5	Protein tyrosine and serine/threonine kinase
14	PF01163 RIO1	95	14.0	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432660	0.999	Cofilin-1
2	9606.ENSP00000400175	0.989	Transforming protein RhoA
3	9606.ENSP00000285735	0.969	Rho-related GTP-binding protein RhoC
4	9606.ENSP00000298159	0.967	Cofilin-2
5	9606.ENSP00000272233	0.963	Rho-related GTP-binding protein RhoB
6	9606.ENSP00000278568	0.962	Serine/threonine-protein kinase PAK 1
7	9606.ENSP00000382697	0.961	Rho-associated protein kinase 1
8	9606.ENSP00000348461	0.960	Ras-related C3 botulinum toxin substrate 1
9	9606.ENSP00000314067	0.952	Serine/threonine-protein kinase PAK 2
10	9606.ENSP00000317985	0.951	Rho-associated protein kinase 2
11	9606.ENSP00000339916	0.950	LIM domain kinase 2
12	9606.ENSP00000413720	0.950	Cyclin-dependent kinase inhibitor 1C
13	9606.ENSP00000312081	0.945	Protein phosphatase Slingshot homolog 3
14	9606.ENSP00000315713	0.939	Protein phosphatase Slingshot homolog 1
15	9606.ENSP00000265362	0.929	Semaphorin-3A
16	9606.ENSP00000311032	0.928	Caspase-3
17	9606.ENSP00000346671	0.928	Tyrosine-protein kinase Fyn
18	9606.ENSP00000383118	0.928	Cell division control protein 42 homolog
19	9606.ENSP00000356000	0.925	Plexin-A2
20	9606.ENSP00000353864	0.921	Serine/threonine-protein kinase PAK 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0031072	0.989	heat shock protein binding
GO:0004674	0.935	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.992	positive regulation of cellular process
GO:0051128	0.986	regulation of cellular component organization
GO:0044087	0.986	regulation of cellular component biogenesis
GO:0071840	0.985	cellular component organization or biogenesis
GO:0016043	0.982	cellular component organization
GO:0110053	0.982	regulation of actin filament organization
GO:0050896	0.981	response to stimulus
GO:0048856	0.972	anatomical structure development
GO:0032501	0.970	multicellular organismal process
GO:0032233	0.967	positive regulation of actin filament bundle assembly
GO:0051716	0.953	cellular response to stimulus
GO:0008152	0.948	metabolic process
GO:0060255	0.917	regulation of macromolecule metabolic process
GO:0120035	0.915	regulation of plasma membrane bounded cell projection organization
GO:0007010	0.886	cytoskeleton organization
GO:0030029	0.882	actin filament-based process
GO:0110020	0.831	regulation of actomyosin structure organization
GO:0051171	0.828	regulation of nitrogen compound metabolic process
GO:0048523	0.818	negative regulation of cellular process
GO:0051492	0.809	regulation of stress fiber assembly
GO:0030036	0.796	actin cytoskeleton organization
GO:0007154	0.778	cell communication
GO:0023052	0.755	signaling
GO:0007275	0.741	multicellular organism development
GO:0007165	0.704	signal transduction
GO:0071704	0.702	organic substance metabolic process
GO:0080090	0.691	regulation of primary metabolic process
GO:0044238	0.654	primary metabolic process
GO:0048731	0.643	system development
GO:0006807	0.611	nitrogen compound metabolic process
GO:0043170	0.570	macromolecule metabolic process
GO:0031323	0.554	regulation of cellular metabolic process
GO:0051246	0.484	regulation of protein metabolic process
GO:1901564	0.478	organonitrogen compound metabolic process
GO:0065008	0.468	regulation of biological quality
GO:0048583	0.461	regulation of response to stimulus
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0044237	0.451	cellular metabolic process
GO:0010646	0.451	regulation of cell communication
GO:0023051	0.450	regulation of signaling
GO:0010604	0.444	positive regulation of macromolecule metabolic process
GO:0048869	0.407	cellular developmental process
GO:0031325	0.388	positive regulation of cellular metabolic process
GO:0030154	0.370	cell differentiation
GO:0009966	0.370	regulation of signal transduction
GO:0043412	0.365	macromolecule modification
GO:0019538	0.342	protein metabolic process
GO:0051239	0.326	regulation of multicellular organismal process
GO:0007166	0.313	cell surface receptor signaling pathway
GO:0065009	0.306	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.998	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005829	0.971	cytosol
GO:0005654	0.957	nucleoplasm
GO:0016607	0.399	nuclear speck
GO:0071944	0.345	cell periphery
GO:0005886	0.334	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]