StarFunc result for job id P53675

User Input

>input (1640 residues)
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
MDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLE
KHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLR
KQEEHVTEPAPLVFDFDGHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1xi4A	0.311	0.313	0.000	1630	0.845	0.850	1xi4A.pdb.gz
2	AFDB:P11442	0.412	0.404	0.000	1675	0.844	0.826	P11442.pdb.gz	CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Cltc PE=1 SV=3
3	AFDB:P22137	0.335	0.332	0.000	1653	0.488	0.485	P22137.pdb.gz	CLH_YEAST Clathrin heavy chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHC1 PE=1 SV=1
4	AFDB:P25870	0.355	0.345	0.000	1694	0.559	0.541	P25870.pdb.gz	CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum OX=44689 GN=chcA PE=1 SV=1
5	AFDB:P29742	0.433	0.424	0.000	1678	0.768	0.750	P29742.pdb.gz	CLH_DROME Clathrin heavy chain OS=Drosophila melanogaster OX=7227 GN=Chc PE=1 SV=1
6	AFDB:P34574	0.376	0.368	0.000	1681	0.693	0.676	P34574.pdb.gz	CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans OX=6239 GN=chc-1 PE=1 SV=1
7	AFDB:P53675	1.000	1.000	0.000	1640	1.000	1.000	P53675.pdb.gz	CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1 PE=1 SV=2
8	AFDB:Q0WNJ6	0.346	0.334	0.000	1705	0.551	0.530	Q0WNJ6.pdb.gz	CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana OX=3702 GN=CHC1 PE=1 SV=1
9	AFDB:Q10161	0.396	0.390	0.000	1666	0.526	0.518	Q10161.pdb.gz	CLH_SCHPO Probable clathrin heavy chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chc1 PE=1 SV=1
10	AFDB:Q38B01	0.344	0.333	0.000	1703	0.379	0.365	Q38B01.pdb.gz	Q38B01_TRYB2 Clathrin heavy chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0830 PE=3 SV=1
11	AFDB:J3KS13	0.272	0.685	1.032E-44	612	0.237	0.636	J3KS13.pdb.gz	J3KS13_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=1
12	PDB:7qpgR	0.117	0.094	1.179E-11	2208	0.144	0.107	7qpgR.pdb.gz
13	PDB:7zu0A	0.171	0.270	9.700E-11	954	0.064	0.110	7zu0A.pdb.gz
14	PDB:6qk7A	0.134	0.180	1.175E-10	1161	0.063	0.090	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
15	PDB:4bujB	0.098	0.112	4.851E-10	1367	0.097	0.116	4bujB.pdb.gz
16	PDB:7r5jK0	0.148	0.211	9.306E-10	1086	0.083	0.125	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7zu0B	0.132	0.265	1.314E-9	733	0.052	0.117	7zu0B.pdb.gz
18	PDB:7r5jT0	0.149	0.224	4.654E-9	1004	0.074	0.121	7r5jT0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7q3eA	0.147	0.370	5.221E-9	551	0.036	0.107	7q3eA.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
20	PDB:7vciR	0.144	0.204	5.425E-9	1082	0.081	0.123	7vciR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WVQ6	0.0	2924	1679	0.846	0.827	A0A087WVQ6_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=1
2	C0MHR2	0.0	2930	1675	0.847	0.829	C0MHR2_PIG Clathrin heavy chain OS=Sus scrofa OX=9823 GN=CLTC PE=1 SV=1
3	J3KS13	0.0	826	612	0.239	0.641	J3KS13_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=1
4	K7EJJ5	0.0	2924	1682	0.847	0.826	K7EJJ5_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=2
5	P11442	0.0	2921	1675	0.845	0.827	CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Cltc PE=1 SV=3
6	P22137	0.0	1612	1653	0.490	0.486	CLH_YEAST Clathrin heavy chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHC1 PE=1 SV=1
7	P25870	0.0	1916	1694	0.560	0.543	CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum OX=44689 GN=chcA PE=1 SV=1
8	P29742	0.0	2650	1678	0.768	0.751	CLH_DROME Clathrin heavy chain OS=Drosophila melanogaster OX=7227 GN=Chc PE=1 SV=1
9	P34574	0.0	2402	1681	0.691	0.674	CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans OX=6239 GN=chc-1 PE=1 SV=1
10	P49951	0.0	2930	1675	0.847	0.829	CLH1_BOVIN Clathrin heavy chain 1 OS=Bos taurus OX=9913 GN=CLTC PE=1 SV=1
11	P53675	0.0	3414	1640	1.000	1.000	CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1 PE=1 SV=2
12	Q00610	0.0	2930	1675	0.847	0.829	CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5
13	Q0WLB5	0.0	1862	1703	0.551	0.531	CLAH2_ARATH Clathrin heavy chain 2 OS=Arabidopsis thaliana OX=3702 GN=CHC2 PE=1 SV=1
14	Q0WNJ6	0.0	1861	1705	0.551	0.530	CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana OX=3702 GN=CHC1 PE=1 SV=1
15	Q10161	0.0	1815	1666	0.524	0.516	CLH_SCHPO Probable clathrin heavy chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chc1 PE=1 SV=1
16	Q38B01	0.0	1212	1703	0.380	0.366	Q38B01_TRYB2 Clathrin heavy chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0830 PE=3 SV=1
17	Q68FD5	0.0	2930	1675	0.846	0.829	CLH1_MOUSE Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3
18	Q8NHS4	7.81e-10	65.9	586	0.029	0.080	CLHC1_HUMAN Clathrin heavy chain linker domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CLHC1 PE=1 SV=3
19	P15498	0.38	37.7	845	0.037	0.072	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
20	Q96D37	0.41	37.7	790	0.038	0.078	Q96D37_HUMAN VAV1 protein OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00637 Clathrin	8.5e-194	646.7	Region in Clathrin and VPS
2	PF09268 Clathrin-link	9.2e-08	42.6	Clathrin, heavy-chain linker
3	PF13838 Clathrin_H_link	1.1e-25	100.7	Clathrin-H-link
4	PF01394 Clathrin_propel	3.2e-42	152.0	Clathrin propeller repeat
5	PF04053 Coatomer_WDAD	0.32	21.7	Coatomer WD associated region
6	PF13424 TPR_12	3.6e+02	12.9	Tetratricopeptide repeat
7	PF14559 TPR_19	18	17.2	Tetratricopeptide repeat
8	PF13176 TPR_7	1.1e+02	14.2	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441158

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242285	0.995	Clathrin light chain A
2	9606.ENSP00000309415	0.995	Clathrin light chain B
3	9606.ENSP00000314499	0.978	Cyclin-G-associated kinase
4	9606.ENSP00000360108	0.962	Putative tyrosine-protein phosphatase auxilin
5	9606.ENSP00000406209	0.954	Epsin-1
6	9606.ENSP00000351926	0.949	AP-2 complex subunit alpha-1
7	9606.ENSP00000336747	0.938	Huntingtin-interacting protein 1
8	9606.ENSP00000482835	0.933	AP-2 complex subunit beta
9	9606.ENSP00000298316	0.932	ADP-ribosylation factor 6
10	9606.ENSP00000327694	0.927	AP-2 complex subunit alpha-2
11	9606.ENSP00000292807	0.925	AP-2 complex subunit mu
12	9606.ENSP00000314615	0.922	ADP-ribosylation factor GTPase-activating protein 1
13	9606.ENSP00000263270	0.920	AP-2 complex subunit sigma
14	9606.ENSP00000409581	0.908	Beta-arrestin-1
15	9606.ENSP00000345195	0.906	Ubiquilin-2
16	9606.ENSP00000347244	0.901	Intersectin-2
17	9606.ENSP00000377015	0.900	Phosphatidylinositol-binding clathrin assembly protein
18	9606.ENSP00000268933	0.899	Epsin-3
19	9606.ENSP00000373905	0.896	Dynamin-2
20	9606.ENSP00000479606	0.891	Clathrin heavy chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.987	localization
GO:0006810	0.977	transport
GO:0006897	0.949	endocytosis
GO:0051641	0.912	cellular localization
GO:0051649	0.892	establishment of localization in cell
GO:0065007	0.856	biological regulation
GO:0050789	0.850	regulation of biological process
GO:0050794	0.720	regulation of cellular process
GO:0071840	0.717	cellular component organization or biogenesis
GO:0016043	0.703	cellular component organization
GO:0032879	0.553	regulation of localization
GO:0046907	0.504	intracellular transport
GO:0006898	0.443	receptor-mediated endocytosis
GO:0048518	0.429	positive regulation of biological process
GO:0048522	0.416	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0071944	0.999	cell periphery
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0030135	0.997	coated vesicle
GO:0005829	0.990	cytosol
GO:0032991	0.986	protein-containing complex
GO:0030136	0.986	clathrin-coated vesicle
GO:0005856	0.985	cytoskeleton
GO:0005886	0.980	plasma membrane
GO:0015630	0.972	microtubule cytoskeleton
GO:0005819	0.958	spindle
GO:0031090	0.950	organelle membrane
GO:0005576	0.910	extracellular region
GO:0098588	0.903	bounding membrane of organelle
GO:0030659	0.893	cytoplasmic vesicle membrane
GO:0005794	0.873	Golgi apparatus
GO:0070062	0.815	extracellular exosome
GO:0005773	0.785	vacuole
GO:0005768	0.744	endosome
GO:0098796	0.663	membrane protein complex
GO:0098791	0.590	Golgi apparatus subcompartment
GO:0098590	0.569	plasma membrane region
GO:0030117	0.546	membrane coat
GO:0005802	0.541	trans-Golgi network
GO:0030665	0.538	clathrin-coated vesicle membrane
GO:0005905	0.438	clathrin-coated pit
GO:0030054	0.435	cell junction
GO:0000323	0.406	lytic vacuole
GO:0070013	0.390	intracellular organelle lumen
GO:0005764	0.374	lysosome
GO:0030139	0.362	endocytic vesicle
GO:0045334	0.340	clathrin-coated endocytic vesicle
GO:0072686	0.334	mitotic spindle
GO:0031981	0.302	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]