StarFunc result for job id P53708

User Input

>input (1063 residues)
MSPGASRGPRGSQAPLIAPLCCAAAALGMLLWSPACQAFNLDVEKLTVYSGPKGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIINLENKTCQVPDSMTSAACFSLRVCASVTGQSIANTIVLMA
EVQLDSLKQKGAIKRTLFLDNHQAHRVFPLVIKRQKSHQCQDFIVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENIVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIP
HLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYTDQPAKLPEGSIVIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDREQLTNDKTPEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4g1eA	0.814	0.893	0.000	964	0.428	0.472	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
2	PDB:7nxdA	0.558	0.649	0.000	905	0.405	0.476	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
3	AFDB:A0A023GU64	0.867	0.870	0.000	1059	0.617	0.619	A0A023GU64.pdb.gz
4	AFDB:A0A0G2JVZ6	0.858	0.867	0.000	1052	0.442	0.447	A0A0G2JVZ6.pdb.gz	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
5	AFDB:A0A0G2K1E2	0.887	0.859	0.000	1099	0.452	0.438	A0A0G2K1E2.pdb.gz	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
6	AFDB:A2ARA8	0.986	0.987	0.000	1062	0.889	0.890	A2ARA8.pdb.gz	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
7	AFDB:B3DIZ6	0.756	0.773	0.000	1037	0.405	0.415	B3DIZ6.pdb.gz
8	AFDB:B3DJQ3	0.881	0.896	0.000	1045	0.452	0.459	B3DJQ3.pdb.gz
9	AFDB:D3ZAC0	0.794	0.814	0.000	1034	0.382	0.393	D3ZAC0.pdb.gz	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
10	AFDB:G3HHR9	0.792	0.890	0.000	944	0.413	0.465	G3HHR9.pdb.gz	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
11	AFDB:L7RXH0	0.869	0.881	0.000	1048	0.470	0.477	L7RXH0.pdb.gz	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
12	AFDB:P08514	0.809	0.827	0.000	1039	0.396	0.405	P08514.pdb.gz	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
13	PDB:3fcsA	0.752	0.867	1.256E-103	913	0.357	0.415	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
14	PDB:7uslA	0.528	0.633	2.205E-61	856	0.191	0.237	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:4nehA	0.521	0.513	7.986E-60	1084	0.190	0.186	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:4nenA	0.479	0.479	9.251E-58	1063	0.193	0.193	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:3k6sC	0.539	0.636	3.793E-55	885	0.193	0.232	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
18	PDB:5a42A	0.134	0.102	1.404E-8	1597	0.103	0.069	5a42A.pdb.gz
19	PDB:7sqcO0	0.101	0.097	1.902E-8	1140	0.056	0.052	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:6xt9A	0.162	0.264	6.732E-8	567	0.081	0.152	6xt9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVZ6	831	1007	0.419	0.442	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
2	A0A0G2K1E2	825	1098	0.421	0.408	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
3	A0A3B3IU79	556	811	0.304	0.398	A0A3B3IU79_HUMAN Integrin subunit alpha 2b (Fragment) OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=1
4	A0A8I5Y696	1829	1009	0.845	0.890	A0A8I5Y696_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
5	A0A8I5YCC9	914	1050	0.441	0.447	A0A8I5YCC9_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
6	A0A8I6A7G7	903	1044	0.435	0.443	A0A8I6A7G7_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
7	A0A8I6GGN2	664	1037	0.389	0.399	A0A8I6GGN2_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=1
8	A0A8I6GID8	1895	1063	0.869	0.869	A0A8I6GID8_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
9	A2ARA8	1965	1062	0.890	0.891	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
10	A2RQD8	954	1046	0.455	0.463	A2RQD8_PIG Alpha v integrin subunit variant OS=Sus scrofa OX=9823 GN=ITGAV PE=2 SV=1
11	B5DEG1	1957	1062	0.889	0.890	B5DEG1_RAT RGD1564327 protein OS=Rattus norvegicus OX=10116 GN=Itga8 PE=2 SV=1
12	D3ZAC0	632	1020	0.376	0.392	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
13	F1LZX9	954	1042	0.448	0.457	F1LZX9_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=4
14	F7F1E3	1942	1086	0.889	0.870	F7F1E3_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
15	G3HHR9	830	944	0.407	0.459	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
16	L7RXH0	951	1048	0.452	0.458	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
17	P06756	951	1048	0.452	0.458	ITAV_HUMAN Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2
18	P08514	687	1039	0.389	0.398	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
19	P08648	902	1049	0.444	0.450	ITA5_HUMAN Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2
20	P11688	915	1053	0.441	0.445	ITA5_MOUSE Integrin alpha-5 OS=Mus musculus OX=10090 GN=Itga5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	5.1e-23	91.8	FG-GAP repeat
2	PF13517 FG-GAP_3	2.2e-05	36.3	FG-GAP-like repeat
3	PF00357 Integrin_alpha	0.086	23.9	Integrin alpha cytoplasmic region
4	PF08441 Integrin_alpha2	2.6e-128	440.7	Integrin alpha
5	PF15686 LYRIC	9.7e+02	10.5	Lysine-rich CEACAM1 co-isolated protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389252	0.997	Nephronectin
2	9606.ENSP00000379350	0.994	Integrin beta-1
3	9606.ENSP00000452786	0.978	Integrin beta-3
4	9606.ENSP00000346839	0.974	Fibronectin type III domain containing
5	9606.ENSP00000283249	0.972	Integrin beta-6
6	9606.ENSP00000380948	0.970	Integrin beta-2
7	9606.ENSP00000267082	0.967	Integrin beta-7
8	9606.ENSP00000222573	0.966	Integrin beta-8
9	9606.ENSP00000296181	0.966	Integrin beta-5
10	9606.ENSP00000226218	0.951	Vitronectin
11	9606.ENSP00000007722	0.943	Integrin alpha-3
12	9606.ENSP00000412940	0.927	FRAS1-related extracellular matrix protein 1
13	9606.ENSP00000200181	0.924	Integrin beta-4
14	9606.ENSP00000282588	0.922	Integrin alpha-1
15	9606.ENSP00000265131	0.920	Tenascin
16	9606.ENSP00000378517	0.919	Osteopontin
17	9606.ENSP00000327290	0.918	Integrin alpha-11
18	9606.ENSP00000358310	0.918	Integrin alpha-10
19	9606.ENSP00000296585	0.916	Integrin alpha-2
20	9606.ENSP00000380227	0.916	Integrin alpha-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0001968	0.997	fibronectin binding
GO:0044877	0.973	protein-containing complex binding
GO:0050839	0.889	cell adhesion molecule binding
GO:0005178	0.555	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.972	cellular process
GO:0007275	0.926	multicellular organism development
GO:0048513	0.840	animal organ development
GO:0048731	0.839	system development
GO:0065007	0.780	biological regulation
GO:0050789	0.619	regulation of biological process
GO:0050794	0.594	regulation of cellular process
GO:0009653	0.536	anatomical structure morphogenesis
GO:0007155	0.478	cell adhesion
GO:0050896	0.350	response to stimulus
GO:0031589	0.324	cell-substrate adhesion
GO:0048518	0.317	positive regulation of biological process
GO:0009888	0.309	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.995	cell junction
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0012505	0.985	endomembrane system
GO:0005737	0.972	cytoplasm
GO:0032991	0.967	protein-containing complex
GO:0005576	0.963	extracellular region
GO:0005615	0.933	extracellular space
GO:0031982	0.932	vesicle
GO:0005925	0.884	focal adhesion
GO:0042995	0.873	cell projection
GO:0120025	0.852	plasma membrane bounded cell projection
GO:0098636	0.821	protein complex involved in cell adhesion
GO:0045202	0.821	synapse
GO:0031252	0.817	cell leading edge
GO:0098978	0.790	glutamatergic synapse
GO:0031256	0.787	leading edge membrane
GO:0098794	0.785	postsynapse
GO:0031253	0.781	cell projection membrane
GO:0065010	0.775	extracellular membrane-bounded organelle
GO:0036477	0.767	somatodendritic compartment
GO:0032279	0.765	asymmetric synapse
GO:1903561	0.765	extracellular vesicle
GO:0032589	0.765	neuron projection membrane
GO:0032590	0.764	dendrite membrane
GO:0098839	0.762	postsynaptic density membrane
GO:0044297	0.760	cell body
GO:0043204	0.749	perikaryon
GO:0098796	0.735	membrane protein complex
GO:0098797	0.733	plasma membrane protein complex
GO:0070062	0.720	extracellular exosome
GO:0009986	0.699	cell surface
GO:0043235	0.696	receptor complex
GO:0098802	0.693	plasma membrane signaling receptor complex
GO:0044309	0.684	neuron spine
GO:0008305	0.676	integrin complex
GO:0043197	0.669	dendritic spine
GO:0005783	0.571	endoplasmic reticulum
GO:0005829	0.462	cytosol
GO:0070013	0.447	intracellular organelle lumen
GO:0031981	0.317	nuclear lumen
GO:0005654	0.305	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]