StarFunc result for job id P53779

User Input

>input (464 residues)
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IKK9	0.852	0.838	3.341E-72	472	0.959	0.943	A0A0R4IKK9.pdb.gz	A0A0R4IKK9_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=2
2	AFDB:P49185	0.810	0.912	3.760E-62	411	0.791	0.893	P49185.pdb.gz	MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus OX=10116 GN=Mapk8 PE=1 SV=1
3	AFDB:P45984	0.780	0.852	5.422E-61	424	0.763	0.835	P45984.pdb.gz	MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2
4	AFDB:Q9DGD9	0.785	0.945	1.323E-57	384	0.685	0.828	Q9DGD9.pdb.gz	MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio OX=7955 GN=mapk8 PE=2 SV=1
5	AFDB:E9QE29	0.779	0.857	3.718E-56	421	0.690	0.760	E9QE29.pdb.gz	E9QE29_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk9 PE=1 SV=1
6	PDB:1jnkA	0.721	0.962	6.267E-54	346	0.741	0.994	1jnkA.pdb.gz	Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.
7	AFDB:P92208	0.764	0.950	2.271E-53	372	0.612	0.763	P92208.pdb.gz	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
8	AFDB:Q8WQG9	0.746	0.747	1.145E-48	463	0.550	0.551	Q8WQG9.pdb.gz	JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans OX=6239 GN=jnk-1 PE=1 SV=2
9	PDB:5awmA	0.719	0.960	3.062E-46	345	0.588	0.791	5awmA.pdb.gz	The crystal structure of JNK from Drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian JNK proteins.
10	AFDB:J3KNK1	0.573	0.773	1.903E-41	339	0.631	0.864	J3KNK1.pdb.gz	J3KNK1_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=1
11	AFDB:O44408	0.743	0.880	1.042E-39	390	0.405	0.482	O44408.pdb.gz	KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans OX=6239 GN=kgb-1 PE=1 SV=2
12	AFDB:O08911	0.711	0.892	4.010E-37	367	0.373	0.471	O08911.pdb.gz	MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus OX=10090 GN=Mapk12 PE=1 SV=1
13	PDB:2lgcA	0.675	0.865	2.994E-34	359	0.364	0.471	2lgcA.pdb.gz
14	PDB:3gc8A	0.672	0.889	1.547E-33	347	0.362	0.484	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
15	PDB:2ewaA	0.663	0.923	2.584E-33	330	0.349	0.491	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
16	PDB:3coiA	0.661	0.877	5.300E-33	344	0.351	0.474	3coiA.pdb.gz
17	PDB:7cgaA	0.667	0.879	1.205E-32	347	0.358	0.478	7cgaA.pdb.gz
18	PDB:7opmA	0.687	0.872	2.053E-29	362	0.312	0.401	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
19	PDB:2zoqA	0.665	0.866	7.035E-29	352	0.306	0.403	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
20	PDB:6dtlB	0.675	0.869	7.083E-28	357	0.297	0.387	6dtlB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4I9H8	778	384	0.795	0.961	A0A0R4I9H8_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
2	A0A0R4IB91	835	433	0.860	0.921	A0A0R4IB91_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
3	A0A0R4IKK9	906	472	0.959	0.943	A0A0R4IKK9_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=2
4	A0A286YFD7	878	426	0.901	0.981	A0A286YFD7_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=1
5	A4QP40	775	384	0.793	0.958	A4QP40_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk10 PE=2 SV=1
6	E9QE29	659	421	0.690	0.760	E9QE29_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk9 PE=1 SV=1
7	P45983	791	427	0.836	0.909	MK08_HUMAN Mitogen-activated protein kinase 8 OS=Homo sapiens OX=9606 GN=MAPK8 PE=1 SV=2
8	P45984	746	424	0.772	0.844	MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2
9	P49185	772	411	0.797	0.900	MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus OX=10116 GN=Mapk8 PE=1 SV=1
10	P49186	737	423	0.763	0.837	MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus OX=10116 GN=Mapk9 PE=1 SV=1
11	P49187	964	464	0.991	0.991	MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus OX=10116 GN=Mapk10 PE=1 SV=3
12	P53779	972	464	1.000	1.000	MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=2
13	P79996	685	382	0.696	0.846	MK09_CHICK Mitogen-activated protein kinase 9 OS=Gallus gallus OX=9031 GN=MAPK9 PE=2 SV=1
14	P92208	617	372	0.614	0.766	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
15	Q32LV0	835	430	0.860	0.928	Q32LV0_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
16	Q499Y8	657	319	0.670	0.975	Q499Y8_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=1
17	Q61831	960	464	0.987	0.987	MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus OX=10090 GN=Mapk10 PE=1 SV=2
18	Q8WQG9	551	463	0.543	0.544	JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans OX=6239 GN=jnk-1 PE=1 SV=2
19	Q91Y86	745	384	0.754	0.911	MK08_MOUSE Mitogen-activated protein kinase 8 OS=Mus musculus OX=10090 GN=Mapk8 PE=1 SV=1
20	Q9DGD9	692	384	0.688	0.831	MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio OX=7955 GN=mapk8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.014	26.1	ABC1 atypical kinase-like domain
2	PF01636 APH	3.7	18.9	Phosphotransferase enzyme family
3	PF13095 FTA2	2.4e+02	12.8	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	1.9e+02	12.4	Haspin like kinase domain
5	PF06293 Kdo	0.0037	28.2	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	1	20.2	Kinase-like
7	PF00069 Pkinase	1.1e-60	216.9	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	2.9e-26	103.9	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	1.1	20.3	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9785.ENSLAFP00000010097

Rank	PPI partner	STRING score	Description
1	9785.ENSLAFP00000016280	0.995	Jun proto-oncogene, AP-1 transcription factor subunit
2	9785.ENSLAFP00000004194	0.992	Mitogen-activated protein kinase kinase 7
3	9785.ENSLAFP00000011256	0.991	Belongs to the protein kinase superfamily.
4	9785.ENSLAFP00000004873	0.977	Uncharacterized protein
5	9785.ENSLAFP00000021392	0.975	Mitogen-activated protein kinase 8 interacting protein 1
6	9785.ENSLAFP00000026560	0.970	Mitogen-activated protein kinase 9
7	9785.ENSLAFP00000019862	0.969	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
8	9785.ENSLAFP00000026385	0.969	Mitogen-activated protein kinase 8 interacting protein 3
9	9785.ENSLAFP00000000827	0.967	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
10	9785.ENSLAFP00000017116	0.962	BCL2-associated agonist of cell death
11	9785.ENSLAFP00000020783	0.961	CRK proto-oncogene, adaptor protein
12	9785.ENSLAFP00000015040	0.960	RAS like proto-oncogene A
13	9785.ENSLAFP00000026008	0.960	RAS like proto-oncogene B
14	9785.ENSLAFP00000012230	0.958	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
15	9785.ENSLAFP00000025642	0.954	Forkhead box O4
16	9785.ENSLAFP00000009331	0.951	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
17	9785.ENSLAFP00000024645	0.951	Mitogen-activated protein kinase 8
18	9785.ENSLAFP00000006503	0.944	Dual specificity phosphatase 1
19	9785.ENSLAFP00000012165	0.940	CRK like proto-oncogene, adaptor protein
20	9785.ENSLAFP00000015626	0.938	Mitogen-activated protein kinase kinase kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004707	0.997	MAP kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0023052	0.971	signaling
GO:0071704	0.949	organic substance metabolic process
GO:0044238	0.941	primary metabolic process
GO:0044237	0.933	cellular metabolic process
GO:0006807	0.920	nitrogen compound metabolic process
GO:0043170	0.915	macromolecule metabolic process
GO:0051716	0.913	cellular response to stimulus
GO:0006468	0.912	protein phosphorylation
GO:0007165	0.896	signal transduction
GO:0019222	0.865	regulation of metabolic process
GO:0006950	0.852	response to stress
GO:0000165	0.820	MAPK cascade
GO:0048518	0.790	positive regulation of biological process
GO:0032501	0.748	multicellular organismal process
GO:0031098	0.695	stress-activated protein kinase signaling cascade
GO:0048522	0.667	positive regulation of cellular process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0080090	0.650	regulation of primary metabolic process
GO:0031323	0.645	regulation of cellular metabolic process
GO:0051171	0.643	regulation of nitrogen compound metabolic process
GO:0032502	0.503	developmental process
GO:0048856	0.456	anatomical structure development
GO:0048583	0.455	regulation of response to stimulus
GO:0042221	0.415	response to chemical
GO:0009889	0.406	regulation of biosynthetic process
GO:0010468	0.394	regulation of gene expression
GO:0009893	0.386	positive regulation of metabolic process
GO:0070887	0.370	cellular response to chemical stimulus
GO:0010556	0.366	regulation of macromolecule biosynthetic process
GO:0031326	0.366	regulation of cellular biosynthetic process
GO:0007166	0.362	cell surface receptor signaling pathway
GO:0019219	0.351	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.336	negative regulation of cellular process
GO:0051252	0.333	regulation of RNA metabolic process
GO:0065009	0.332	regulation of molecular function
GO:0006355	0.321	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.965	cytosol
GO:0016020	0.852	membrane
GO:0005886	0.778	plasma membrane
GO:0012505	0.617	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.24	0.997	mitogen-activated protein kinase.

[back to server]