StarFunc result for job id P53801

User Input

>input (180 residues)
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWC
NTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCC
CRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53801	1.000	1.000	8.100E-32	180	1.000	1.000	P53801.pdb.gz	PTTG_HUMAN Pituitary tumor-transforming gene 1 protein-interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1
2	AFDB:Q5XJ41	0.541	0.565	1.078E-16	172	0.444	0.465	Q5XJ41.pdb.gz	Q5XJ41_DANRE PTTG1-interacting protein b OS=Danio rerio OX=7955 GN=pttg1ip PE=2 SV=1
3	AFDB:A8MXQ1	0.319	0.354	2.126E-16	159	0.700	0.792	A8MXQ1.pdb.gz	A8MXQ1_HUMAN PTTG1 interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1
4	AFDB:A8MZH8	0.325	0.526	3.212E-15	107	0.517	0.869	A8MZH8.pdb.gz	A8MZH8_HUMAN PTTG1 interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1
5	AFDB:Q9TXH9	0.299	0.197	8.382E-1	299	0.161	0.097	Q9TXH9.pdb.gz	UBXN1_CAEEL UBX domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ubxn-1 PE=1 SV=1
6	AFDB:P26012	0.207	0.056	1.443	769	0.106	0.025	P26012.pdb.gz	ITB8_HUMAN Integrin beta-8 OS=Homo sapiens OX=9606 GN=ITGB8 PE=1 SV=1
7	AFDB:Q9FI47	0.178	0.199	1.653	154	0.117	0.136	Q9FI47.pdb.gz	Q9FI47_ARATH Rubredoxin-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g51010 PE=1 SV=1
8	AFDB:Q9VSC5	0.190	0.113	2.321	331	0.156	0.085	Q9VSC5.pdb.gz	Q9VSC5_DROME GM09977p OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.138 PE=1 SV=1
9	AFDB:Q8VZJ1	0.129	0.073	2.845	379	0.089	0.042	Q8VZJ1.pdb.gz	ATXR5_ARATH Histone-lysine N-methyltransferase ATXR5 OS=Arabidopsis thaliana OX=3702 GN=ATXR5 PE=1 SV=2
10	PDB:4arzA	0.093	0.061	3.118	291	0.061	0.038	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
11	PDB:6qp7A	0.124	0.040	3.337	620	0.039	0.011	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	AFDB:Q80V85	0.258	0.122	3.487	475	0.128	0.048	Q80V85.pdb.gz	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
13	PDB:2carA	0.092	0.085	5.015	196	0.067	0.061	2carA.pdb.gz
14	PDB:7ajtCL	0.171	0.048	7.041	781	0.133	0.031	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7dmpC	0.111	0.088	7.041	242	0.039	0.029	7dmpC.pdb.gz
16	PDB:3j79f	0.126	0.339	7.536	51	0.039	0.137	3j79f.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:5w0pC	0.142	0.039	7.536	850	0.083	0.018	5w0pC.pdb.gz
18	PDB:6vxkB	0.149	0.038	7.536	747	0.056	0.013	6vxkB.pdb.gz
19	PDB:2p6aD	0.094	0.067	8.065	292	0.056	0.034	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
20	PDB:3u31A	0.157	0.114	8.065	263	0.033	0.023	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53801	3.90e-131	366	180	1.000	1.000	PTTG_HUMAN Pituitary tumor-transforming gene 1 protein-interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1
2	A8MXQ1	5.70e-88	256	159	0.689	0.780	A8MXQ1_HUMAN PTTG1 interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1
3	A8MZH8	1.88e-51	162	107	0.517	0.869	A8MZH8_HUMAN PTTG1 interacting protein OS=Homo sapiens OX=9606 GN=PTTG1IP PE=1 SV=1
4	Q5XJ41	4.30e-49	158	172	0.439	0.459	Q5XJ41_DANRE PTTG1-interacting protein b OS=Danio rerio OX=7955 GN=pttg1ip PE=2 SV=1
5	Q9LK35	0.31	33.9	855	0.094	0.020	THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana OX=3702 GN=THE1 PE=1 SV=1
6	P33332	0.33	33.9	1336	0.089	0.012	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
7	Q7T1R3	0.35	33.5	1127	0.100	0.016	Q7T1R3_DANRE ASIP OS=Danio rerio OX=7955 GN=bazooka PE=1 SV=1
8	Q9JKA5	0.42	33.1	319	0.106	0.060	GPA33_MOUSE Cell surface A33 antigen OS=Mus musculus OX=10090 GN=Gpa33 PE=2 SV=2
9	Q17328	0.74	32.3	434	0.167	0.069	GLUCB_CAEEL Glutamate-gated chloride channel subunit beta OS=Caenorhabditis elegans OX=6239 GN=glc-2 PE=1 SV=1
10	F1QBZ9	0.77	32.7	2870	0.094	0.006	F1QBZ9_DANRE Multiple EGF-like-domains 8 OS=Danio rerio OX=7955 GN=megf8 PE=4 SV=2
11	Q91YJ5	0.98	32.3	727	0.094	0.023	IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus OX=10090 GN=Mtif2 PE=1 SV=2
12	C5H5I1	1.0	32.3	1864	0.056	0.005	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
13	F1QBC0	1.0	32.3	1864	0.056	0.005	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
14	Q6FRZ8	1.5	31.6	588	0.089	0.027	AP1_CANGA bZip transcription factor GAP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AP1 PE=3 SV=1
15	Q80YR5	1.5	31.6	991	0.089	0.016	SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus musculus OX=10090 GN=Safb2 PE=1 SV=2
16	Q9R1S4	1.7	31.2	267	0.111	0.075	XBP1_RAT X-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Xbp1 PE=2 SV=1
17	O35426	1.9	31.2	267	0.111	0.075	XBP1_MOUSE X-box-binding protein 1 OS=Mus musculus OX=10090 GN=Xbp1 PE=1 SV=2
18	P34498	1.9	31.6	1131	0.089	0.014	MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans OX=6239 GN=mog-1 PE=1 SV=2
19	F1N2N9	2.0	31.2	687	0.078	0.020	ODAD1_BOVIN Outer dynein arm-docking complex subunit 1 OS=Bos taurus OX=9913 GN=ODAD1 PE=1 SV=3
20	Q8I4Z1	2.0	31.6	1846	0.089	0.009	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03918 CcmH	5.8e+02	11.1	Cytochrome C biogenesis protein
2	PF07213 DAP10	32	15.9	DAP10 membrane protein
3	PF14575 EphA2_TM	25	17.1	Ephrin type-A receptor 2 transmembrane domain
4	PF14851 FAM176	1.3e+02	13.7	FAM176 family
5	PF15741 LRIF1	3.1e+02	11.3	Ligand-dependent nuclear receptor-interacting factor 1
6	PF15345 TMEM51	1.4e+02	13.6	Transmembrane protein 51

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.786	Cellular tumor antigen p53
2	9606.ENSP00000377536	0.773	Securin
3	9606.ENSP00000383376	0.613	Junctional adhesion molecule B
4	9606.ENSP00000291547	0.606	Homeobox protein PKNOX1
5	9606.ENSP00000381266	0.574	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
6	9606.ENSP00000448083	0.543	Two pore calcium channel protein 1
7	9606.ENSP00000346196	0.539	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
8	9606.ENSP00000381231	0.538	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
9	9606.ENSP00000409667	0.538	Synaptojanin-1
10	9606.ENSP00000381234	0.536	annotation not available
11	9606.ENSP00000292879	0.535	Splicing factor U2AF 35 kDa subunit-like protein
12	9606.ENSP00000363654	0.512	Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP (By similarity)
13	9606.ENSP00000404782	0.511	A-kinase anchor protein 2
14	9606.ENSP00000369325	0.503	Cyclin-dependent kinase-like 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.969	cellular process
GO:0050789	0.967	regulation of biological process
GO:0050794	0.959	regulation of cellular process
GO:0009893	0.958	positive regulation of metabolic process
GO:1901796	0.920	regulation of signal transduction by p53 class mediator
GO:0043066	0.910	negative regulation of apoptotic process
GO:0080135	0.900	regulation of cellular response to stress
GO:0046907	0.897	intracellular transport
GO:2001242	0.869	regulation of intrinsic apoptotic signaling pathway
GO:0051173	0.863	positive regulation of nitrogen compound metabolic process
GO:0010604	0.857	positive regulation of macromolecule metabolic process
GO:0080090	0.831	regulation of primary metabolic process
GO:1902532	0.830	negative regulation of intracellular signal transduction
GO:2001020	0.807	regulation of response to DNA damage stimulus
GO:1901797	0.807	negative regulation of signal transduction by p53 class mediator
GO:1903320	0.798	regulation of protein modification by small protein conjugation or removal
GO:0051247	0.798	positive regulation of protein metabolic process
GO:0033365	0.787	protein localization to organelle
GO:2001234	0.776	negative regulation of apoptotic signaling pathway
GO:2001021	0.771	negative regulation of response to DNA damage stimulus
GO:0051169	0.767	nuclear transport
GO:0034504	0.766	protein localization to nucleus
GO:0045184	0.760	establishment of protein localization
GO:0031401	0.754	positive regulation of protein modification process
GO:0071705	0.752	nitrogen compound transport
GO:0015031	0.741	protein transport
GO:0006913	0.734	nucleocytoplasmic transport
GO:1902253	0.733	regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:0051170	0.698	import into nucleus
GO:0043516	0.687	regulation of DNA damage response, signal transduction by p53 class mediator
GO:1903322	0.589	positive regulation of protein modification by small protein conjugation or removal
GO:0072594	0.552	establishment of protein localization to organelle
GO:0031396	0.545	regulation of protein ubiquitination
GO:0031398	0.399	positive regulation of protein ubiquitination
GO:2001243	0.396	negative regulation of intrinsic apoptotic signaling pathway
GO:0006886	0.386	intracellular protein transport
GO:0006606	0.371	protein import into nucleus
GO:0071704	0.316	organic substance metabolic process
GO:0048522	0.310	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.999	membrane
GO:0005737	0.976	cytoplasm
GO:0031982	0.969	vesicle
GO:0005576	0.911	extracellular region
GO:0005615	0.838	extracellular space
GO:0070062	0.806	extracellular exosome
GO:0071944	0.778	cell periphery
GO:0005886	0.594	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]