StarFunc result for job id P53804

User Input

>input (2025 residues)
MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSER
NLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCVDANNSRASEI
NLKKLQHLELMEDIVDLAKKVANDSFLIGGLLRIGCKIENKILAMEEALNWIKYAGDVTI
LTKLGSIDNCWPMLSIFFTEYKYHITKIVMEDCNLLEELKTQSCMDCIEEGELMKMKGNE
EFSKERFDIAIIYYTRAIEYRPENYLLYGNRALCFLRTGQFRNALGDGKRATILKNTWPK
GHYRYCDALSMLGEYDWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQIEDLQGRTANK
DPIKAFYENRAYTPRSLSAPIFTTSLNFVEKERDFRKINHEMANGGNQNLKVADEALKVD
DCDCHPEFSPPSSQPPKHKGKQKSRNNESEKFSSSSPLTLPADLKNILEKQFSKSSRAAH
QDFANIMKMLRSLIQDGYMALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLVVY
GLAISLLGIGQPEELSEAENQFKRIIEHYPSEGLDCLAYCGIGKVYLKKNRFLEALNHFE
KARTLIYRLPGVLTWPTSNVIIEESQPQKIKMLLEKFVEECKFPPVPDAICCYQKCHGYS
KIQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCEG
VISKIIIFSSGGEVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKKLKRKIQKKEA
KKLAQERMEEDLRESNPPKNEEQKETVDNVQRCQFLDDRILQCIKQYADKIKSGIQNTAM
LLKELLSWKVLSTEDYTTCFSSRNFLNEAVDYVIRHLIQENNRVKTRIFLHVLSELKEVE
PKLAAWIQKLNSFGLDATGTFFSRYGASLKLLDFSIMTFLWNEKYGHKLDSIEGKQLDYF
SEPASLKEARCLIWLLEEHRDKFPALHSALDEFFDIMDSRCTVLRKQDSGEAPFSSTKVK
NKSKKKKPKDSKPMLVGSGTTSVTSNNEIITSSEDHSNRNSDSAGPFAVPDHLRQDVEEF
EALYDQHSNEYVVRNKKLWDMNPKQKCSTLYDYFSQFLEEHGPLDMSNKMFSAEYEFFPE
ETRQILEKAGGLKPFLLGCPRFVVIDNCIALKKVASRLKKKRKKKNIKTKVEEISKAGEY
VRVKLQLNPAAREFKPDVKSKPVSDSSSAPAFENVKPKPVSANSPKPACEDVKAKPVSDN
SSRQVSEDGQPKGVSSNSPKPGSEDANYKRVSCNSPKPVLEDVKPTYWAQSHLVTGYCTY
LPFQRFDITQTPPAYINVLPGLPQYTSIYTPLASLSPEYQLPRSVPVVPSFVANDRADKN
AAAYFEGHHLNAENVAGHQIASETQILEGSLGISVKSHCSTGDAHTVLSESNRNDEHCGN
SNNKCEVIPESTSAVTNIPHVQMVAIQVSWNIIHQEVNTEPYNPFEERQGEISRIEKEHQ
VLQDQLQEVYENYEQIKLKGLEETRDLEEKLKRHLEENKISKTELDWFLQDLEREIKKWQ
QEKKEIQERLKSLKKKIKKVSNASEMYTQKNDGKEKEHELHLDQSLEISNTLTNEKMKIE
EYIKKGKEDYEESHQRAVAAEVSVLENWKESEVYKLQIMESQAEAFLKKLGLISRDPAAY
PDMESDIRSWELFLSNVTKEIEKAKSQFEEQIKAIKNGSRLSELSKVQISELSFPACNTV
HPELLPESSGDDGQGLVTSASDVTGNHAALHRDPSVFSAGDSPGEAPSALLPGPPPGQPE
ATQLTGPKRAGQAALSERSPVADRKQPVPPGRAARSSQSPKKPFNSIIEHLSVVFPCYNS
TELAGFIKKVRSKNKNSLSGLSIDEIVQRVTEHILDEQKKKKPNPGKDKRTYEPSSATPV
TRSSQGSPSVVVAPSPKTKGQKAEDVPVRIALGASSCEICHEVFKSKNVRVLKCGHKYHK
GCFKQWLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88196	0.364	0.371	0.000	1979	0.753	0.770	O88196.pdb.gz	TTC3_MOUSE E3 ubiquitin-protein ligase TTC3 OS=Mus musculus OX=10090 GN=Ttc3 PE=1 SV=2
2	AFDB:P53804	1.000	1.000	0.000	2025	1.000	1.000	P53804.pdb.gz	TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens OX=9606 GN=TTC3 PE=1 SV=2
3	AFDB:Q9H6T3	0.061	0.173	3.244E-7	665	0.050	0.152	Q9H6T3.pdb.gz	RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2
4	PDB:7kw7E	0.060	0.336	3.186E-5	327	0.031	0.193	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
5	PDB:7obeA	0.059	0.243	3.618E-5	480	0.017	0.073	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
6	PDB:2y4uA	0.102	0.388	4.475E-5	424	0.038	0.179	2y4uA.pdb.gz
7	AFDB:Q9Z0Y8	0.048	0.046	6.291E-5	2201	0.090	0.083	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
8	PDB:1wao1	0.060	0.248	1.003E-4	471	0.021	0.091	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
9	PDB:7qe7K	0.083	0.253	1.003E-4	531	0.039	0.147	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
10	AFDB:Q0KK59	0.057	0.049	1.190E-4	2596	0.095	0.074	Q0KK59.pdb.gz	UNC79_MOUSE Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1
11	PDB:1ihgA	0.061	0.321	1.742E-4	364	0.016	0.088	1ihgA.pdb.gz
12	PDB:7ntfA	0.081	0.149	1.897E-4	918	0.040	0.087	7ntfA.pdb.gz
13	PDB:4bujB	0.086	0.117	2.780E-4	1367	0.034	0.050	4bujB.pdb.gz
14	PDB:2c2lA	0.056	0.370	3.438E-4	281	0.017	0.125	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
15	AFDB:O88427	0.050	0.045	4.833E-4	2365	0.096	0.082	O88427.pdb.gz	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
16	AFDB:O95180	0.050	0.046	5.490E-4	2353	0.092	0.079	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
17	PDB:7dhgC	0.061	0.241	5.724E-4	470	0.032	0.136	7dhgC.pdb.gz
18	AFDB:Q8I3F9	0.083	0.065	7.391E-4	2675	0.080	0.060	Q8I3F9.pdb.gz	Q8I3F9_PLAF7 Formin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0530900 PE=4 SV=1
19	AFDB:Q9VW47	0.065	0.055	2.327E-3	2531	0.115	0.092	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
20	AFDB:Q4G0F8	0.039	0.055	8.685E-3	1135	0.071	0.127	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88196	0.0	3003	1979	0.753	0.770	TTC3_MOUSE E3 ubiquitin-protein ligase TTC3 OS=Mus musculus OX=10090 GN=Ttc3 PE=1 SV=2
2	P53804	0.0	4202	2025	1.000	1.000	TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens OX=9606 GN=TTC3 PE=1 SV=2
3	Q86Y13	5.48e-23	110	1208	0.061	0.103	DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens OX=9606 GN=DZIP3 PE=1 SV=2
4	Q57ZX0	7.62e-12	72.8	550	0.019	0.069	Q57ZX0_TRYB2 Stress-induced protein sti1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.210 PE=4 SV=1
5	P53042	3.76e-11	70.5	499	0.019	0.076	PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Ppp5c PE=1 SV=1
6	Q9USI5	4.41e-11	70.5	591	0.018	0.063	STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sti1 PE=3 SV=1
7	Q60676	5.96e-11	69.7	499	0.019	0.076	PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus OX=10090 GN=Ppp5c PE=1 SV=3
8	P53041	6.33e-11	69.7	499	0.017	0.070	PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1
9	Q54DA8	2.04e-10	68.2	564	0.022	0.080	STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum OX=44689 GN=sti1 PE=3 SV=1
10	K7EK03	3.06e-10	65.1	242	0.015	0.124	K7EK03_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=10
11	K7EIH8	5.57e-10	64.7	267	0.015	0.112	K7EIH8_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=9
12	A0A6I8PS32	8.05e-10	65.9	467	0.015	0.064	A0A6I8PS32_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
13	Q7ZWU1	9.22e-10	65.9	543	0.016	0.061	STIP1_XENLA Stress-induced-phosphoprotein 1 OS=Xenopus laevis OX=8355 GN=stip1 PE=2 SV=1
14	A0A6I8PUD4	1.08e-09	65.5	481	0.015	0.062	A0A6I8PUD4_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
15	A0A6I8PU89	1.79e-09	63.9	347	0.015	0.086	A0A6I8PU89_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
16	A0A6I8PU73	5.30e-09	63.5	497	0.015	0.060	A0A6I8PU73_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
17	Q99615	5.40e-09	63.5	494	0.015	0.061	DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
18	Q9LNB6	5.52e-09	63.5	572	0.017	0.059	HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana OX=3702 GN=HOP1 PE=2 SV=1
19	G1TAF8	7.62e-09	63.2	543	0.022	0.081	G1TAF8_RABIT Stress induced phosphoprotein 1 OS=Oryctolagus cuniculus OX=9986 GN=STIP1 PE=4 SV=2
20	Q9NES8	9.34e-09	62.8	496	0.019	0.079	PPP5_CAEEL Serine/threonine-protein phosphatase 5 OS=Caenorhabditis elegans OX=6239 GN=pph-5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	3.3	19.4	Anaphase-promoting complex, cyclosome, subunit 3
2	PF14446 Prok-RING_1	50	15.3	Prokaryotic RING finger family 1
3	PF00515 TPR_1	8.1e-06	36.6	Tetratricopeptide repeat
4	PF13414 TPR_11	0.84	20.7	TPR repeat
5	PF13424 TPR_12	0.33	22.6	Tetratricopeptide repeat
6	PF13432 TPR_16	0.12	24.3	Tetratricopeptide repeat
7	PF13431 TPR_17	3.6	19.2	Tetratricopeptide repeat
8	PF14559 TPR_19	5.2e+02	12.5	Tetratricopeptide repeat
9	PF07719 TPR_2	0.00012	33.0	Tetratricopeptide repeat
10	PF13181 TPR_8	12	17.4	Tetratricopeptide repeat
11	PF13371 TPR_9	6.6e+02	11.8	Tetratricopeptide repeat
12	PF19179 TTC3_DZIP3_dom	3e-47	170.5	E3 ubiquitin-protein ligase TTC3/DZIP3 domain
13	PF00097 zf-C3HC4	0.0014	29.8	Zinc finger, C3HC4 type (RING finger)
14	PF13923 zf-C3HC4_2	0.00036	31.6	Zinc finger, C3HC4 type (RING finger)
15	PF13920 zf-C3HC4_3	1.3	20.2	Zinc finger, C3HC4 type (RING finger)
16	PF12678 zf-rbx1	0.027	26.1	RING-H2 zinc finger domain
17	PF17123 zf-RING_11	2.7	19.1	RING-like zinc finger
18	PF13639 zf-RING_2	5.3e-06	38.0	Ring finger domain
19	PF14634 zf-RING_5	0.19	23.0	zinc-RING finger domain
20	PF13445 zf-RING_UBOX	1.6	20.2	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344674	0.815	Dehydrogenase/reductase SDR family member 2, mitochondrial
2	9606.ENSP00000434142	0.655	Tumor protein D52 like 1
3	9606.ENSP00000273353	0.648	Myosin-15
4	9606.ENSP00000311399	0.628	Down syndrome critical region gene 3
5	9606.ENSP00000470298	0.615	Myosin-14
6	9606.ENSP00000216218	0.601	Hsc70-interacting protein
7	9606.ENSP00000404570	0.586	Myosin-13
8	9606.ENSP00000420037	0.585	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
9	9606.ENSP00000353590	0.582	Myosin-10
10	9606.ENSP00000255381	0.581	Myosin-4
11	9606.ENSP00000265056	0.570	DNA replication licensing factor MCM2
12	9606.ENSP00000381717	0.567	Ubiquitin-conjugating enzyme E2 D2
13	9606.ENSP00000265148	0.556	Centromere-associated protein E
14	9606.ENSP00000262873	0.550	Myosin-7B
15	9606.ENSP00000384330	0.549	Myosin-8
16	9606.ENSP00000464317	0.547	Myosin-3
17	9606.ENSP00000480484	0.538	Trichohyalin
18	9606.ENSP00000451828	0.527	RAC-alpha serine/threonine-protein kinase
19	9606.ENSP00000375892	0.509	RAC-beta serine/threonine-protein kinase
20	9606.ENSP00000264198	0.503	Mitochondrial ubiquitin ligase activator of NFKB 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.998	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0008152	0.985	metabolic process
GO:0044238	0.981	primary metabolic process
GO:1901564	0.975	organonitrogen compound metabolic process
GO:0043170	0.965	macromolecule metabolic process
GO:0044237	0.952	cellular metabolic process
GO:0019538	0.946	protein metabolic process
GO:0065007	0.899	biological regulation
GO:0050789	0.869	regulation of biological process
GO:0036211	0.815	protein modification process
GO:0016567	0.779	protein ubiquitination
GO:0006508	0.735	proteolysis
GO:0051603	0.704	proteolysis involved in protein catabolic process
GO:0006511	0.646	ubiquitin-dependent protein catabolic process
GO:0050794	0.606	regulation of cellular process
GO:0000209	0.523	protein polyubiquitination
GO:0070936	0.312	protein K48-linked ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005829	0.995	cytosol
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005730	0.481	nucleolus
GO:0032991	0.328	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]