StarFunc result for job id P53805

User Input

>input (252 residues)
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVD
LQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAA
DARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATP
VINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQ
TRRPEYTPIHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53805	1.000	1.000	5.196E-47	252	1.000	1.000	P53805.pdb.gz	RCAN1_HUMAN Calcipressin-1 OS=Homo sapiens OX=9606 GN=RCAN1 PE=1 SV=4
2	AFDB:Q6IN33	0.378	0.468	7.241E-31	199	0.679	0.859	Q6IN33.pdb.gz	RCAN1_RAT Calcipressin-1 OS=Rattus norvegicus OX=10116 GN=Rcan1 PE=2 SV=1
3	AFDB:Q9UKA8	0.352	0.366	2.469E-26	241	0.488	0.510	Q9UKA8.pdb.gz	RCAN3_HUMAN Calcipressin-3 OS=Homo sapiens OX=9606 GN=RCAN3 PE=1 SV=1
4	AFDB:Q9JHG2	0.372	0.466	2.510E-25	197	0.476	0.609	Q9JHG2.pdb.gz	RCAN2_MOUSE Calcipressin-2 OS=Mus musculus OX=10090 GN=Rcan2 PE=1 SV=1
5	AFDB:B0R069	0.414	0.494	2.855E-25	210	0.472	0.567	B0R069.pdb.gz
6	AFDB:B0R065	0.323	0.485	4.143E-22	166	0.401	0.608	B0R065.pdb.gz
7	AFDB:Q9XZL8	0.348	0.302	1.738E-20	292	0.329	0.284	Q9XZL8.pdb.gz	SRA_DROME Protein sarah OS=Drosophila melanogaster OX=7227 GN=sra PE=1 SV=1
8	AFDB:P53806	0.391	0.463	2.775E-19	207	0.302	0.367	P53806.pdb.gz	RCANL_CAEEL Calcipressin-like protein OS=Caenorhabditis elegans OX=6239 GN=rcan-1 PE=1 SV=2
9	AFDB:Q4X0L5	0.283	0.249	2.883E-9	288	0.218	0.191	Q4X0L5.pdb.gz	Q4X0L5_ASPFU Calcineurin binding protein, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G13060 PE=3 SV=1
10	AFDB:C8V1J5	0.299	0.252	3.075E-9	301	0.194	0.163	C8V1J5.pdb.gz	C8V1J5_EMENI Calcineurin binding protein, putative (AFU_orthologue AFUA_2G13060) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06249 PE=3 SV=1
11	PDB:6ff7X	0.275	0.394	8.378E-6	171	0.095	0.140	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:3lqvB	0.260	0.539	5.788E-5	115	0.032	0.070	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:6exnY	0.285	0.751	9.691E-5	87	0.063	0.184	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
14	PDB:5yzg1	0.243	0.252	1.731E-4	243	0.056	0.058	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:7r5jF0	0.248	0.259	2.388E-4	241	0.103	0.108	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:3jb9k	0.262	0.674	2.717E-4	89	0.087	0.247	3jb9k.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:6y5qq	0.253	0.347	2.897E-4	178	0.052	0.073	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:3pgwP	0.278	0.577	3.090E-4	113	0.060	0.133	3pgwP.pdb.gz
19	PDB:5lsbA	0.249	0.347	3.090E-4	176	0.048	0.068	5lsbA.pdb.gz
20	PDB:7dvqI	0.259	0.478	4.549E-4	128	0.060	0.117	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53805	0.0	522	252	1.000	1.000	RCAN1_HUMAN Calcipressin-1 OS=Homo sapiens OX=9606 GN=RCAN1 PE=1 SV=4
2	Q9JHG6	2.91e-158	441	251	0.921	0.924	RCAN1_MOUSE Calcipressin-1 OS=Mus musculus OX=10090 GN=Rcan1 PE=1 SV=2
3	Q6IN33	1.33e-116	333	199	0.683	0.864	RCAN1_RAT Calcipressin-1 OS=Rattus norvegicus OX=10116 GN=Rcan1 PE=2 SV=1
4	Q9JHG2	3.35e-80	241	197	0.472	0.604	RCAN2_MOUSE Calcipressin-2 OS=Mus musculus OX=10090 GN=Rcan2 PE=1 SV=1
5	Q6DC33	2.94e-72	221	210	0.472	0.567	Q6DC33_DANRE Calcipressin-1 OS=Danio rerio OX=7955 GN=zgc:100963 PE=2 SV=1
6	Q9UKA8	6.84e-72	221	241	0.472	0.494	RCAN3_HUMAN Calcipressin-3 OS=Homo sapiens OX=9606 GN=RCAN3 PE=1 SV=1
7	P53806	9.57e-43	146	207	0.298	0.362	RCANL_CAEEL Calcipressin-like protein OS=Caenorhabditis elegans OX=6239 GN=rcan-1 PE=1 SV=2
8	Q9XZL8	5.47e-38	136	292	0.290	0.250	SRA_DROME Protein sarah OS=Drosophila melanogaster OX=7227 GN=sra PE=1 SV=1
9	Q09791	0.017	37.4	163	0.071	0.110	YA9F_SCHPO Uncharacterized protein C13G6.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC13G6.15c PE=3 SV=1
10	Q39244	0.052	36.6	250	0.123	0.124	RU1A_ARATH U1 small nuclear ribonucleoprotein A OS=Arabidopsis thaliana OX=3702 GN=U1A PE=1 SV=1
11	O04319	0.45	34.3	537	0.060	0.028	PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana OX=3702 GN=PAB6 PE=2 SV=1
12	P36054	2.7	31.2	211	0.063	0.076	RCN1_YEAST Calcipressin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RCN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04847 Calcipressin	8.6e-61	216.4	Calcipressin
2	PF13897 GOLD_2	3.6e+02	13.1	Golgi-dynamics membrane-trafficking

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000012717

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000016705	0.921	Protein phosphatase 3, catalytic subunit, alpha isozyme
2	9601.ENSPPYP00000012738	0.800	Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
3	9601.ENSPPYP00000002711	0.637	Protein phosphatase 3, catalytic subunit, beta isozyme
4	9601.ENSPPYP00000023279	0.635	Multifunctional polyribosome-associated RNA-binding protein that plays a central role in neuronal development and synaptic plasticity through the regulation of alternative mRNA splicing, mRNA stability, mRNA dendritic transport and postsynaptic local protein synthesis of a subset of mRNAs. Plays a role in the alternative splicing of its own mRNA. Plays a role in mRNA nuclear export. Together with export factor NXF2, is involved in the regulation of the NXF1 mRNA stability in neurons. Stabilizes the scaffolding postsynaptic density protein DLG4/PSD-95 and the myelin basic protein (MBP) [...]
5	9601.ENSPPYP00000020644	0.615	Protein phosphatase 3, catalytic subunit, gamma isozyme
6	9601.ENSPPYP00000001983	0.589	Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar prefer [...]
7	9601.ENSPPYP00000011170	0.574	Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
8	9601.ENSPPYP00000008476	0.555	Nuclear factor of activated T-cells 5, tonicity-responsive
9	9601.ENSPPYP00000001987	0.554	NIPA-like protein 3
10	9601.ENSPPYP00000022720	0.551	Ubiquitously-expressed, prefoldin-like chaperone
11	9601.ENSPPYP00000012737	0.539	Pongo abelii Down syndrome critical region gene 3 (DSCR3), mRNA
12	9601.ENSPPYP00000013774	0.529	Uncharacterized protein
13	9601.ENSPPYP00000003774	0.526	Olfactory receptor, family 4, subfamily C, member 3
14	9601.ENSPPYP00000006613	0.522	Catalytically inactive phosphatase. Acts as a nuclear anchor for MAPK1/MAPK3 (ERK1/ERK2). Modulates cell-fate decisions and cell migration by spatiotemporal regulation of MAPK1/MAPK3 (ERK1/ERK2) (By similarity). Seems to play a role in spermiogenesis (By similarity).
15	9601.ENSPPYP00000008249	0.522	Syntaxin 4
16	9601.ENSPPYP00000010390	0.521	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
17	9601.ENSPPYP00000012741	0.520	Down syndrome critical region gene 4
18	9601.ENSPPYP00000012742	0.520	Down syndrome critical region gene 8
19	9601.ENSPPYP00000012893	0.520	This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G- protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium
20	9601.ENSPPYP00000012629	0.515	Amyloid beta (A4) precursor protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.949	identical protein binding
GO:0019899	0.590	enzyme binding
GO:0098772	0.380	molecular function regulator activity
GO:0019902	0.303	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.926	cellular process
GO:0048519	0.869	negative regulation of biological process
GO:0050896	0.783	response to stimulus
GO:0048523	0.757	negative regulation of cellular process
GO:0010646	0.733	regulation of cell communication
GO:0023051	0.731	regulation of signaling
GO:0051716	0.656	cellular response to stimulus
GO:0048583	0.617	regulation of response to stimulus
GO:0019222	0.568	regulation of metabolic process
GO:0031323	0.552	regulation of cellular metabolic process
GO:1902532	0.533	negative regulation of intracellular signal transduction
GO:0080090	0.532	regulation of primary metabolic process
GO:0060255	0.532	regulation of macromolecule metabolic process
GO:0051171	0.530	regulation of nitrogen compound metabolic process
GO:0048856	0.469	anatomical structure development
GO:0032501	0.459	multicellular organismal process
GO:0048518	0.414	positive regulation of biological process
GO:0006950	0.390	response to stress
GO:0031399	0.386	regulation of protein modification process
GO:0051174	0.379	regulation of phosphorus metabolic process
GO:0007165	0.359	signal transduction
GO:0048522	0.358	positive regulation of cellular process
GO:0019220	0.356	regulation of phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.998	nucleus
GO:0005829	0.664	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]