StarFunc result for job id P53992

User Input

>input (1094 residues)
MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPGYQQTPPQGMS
RAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQ
PPVLQPYGPPPTSAQVATQLSGMQISGAVAPAPPSSGLGFGPPTSLASASGSFPNSGLYG
SYPQGQAPPLSQAQGHPGIQTPQRSAPSQASSFTPPASGGPRLPSMTGPLLPGQSFGGPS
VSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPY
PAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTN
FLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELS
LGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGA
EESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITS
LLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDD
RKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSV
YKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVEL
AGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR
NCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPEC
MKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVE
STTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSV
LPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVD
FLCHMHKEIRQLLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QRB4	0.711	0.755	0.000	1030	0.558	0.592	F1QRB4.pdb.gz	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2
2	AFDB:G3X972	0.789	0.788	0.000	1096	0.926	0.924	G3X972.pdb.gz	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
3	AFDB:Q6NXL1	0.721	0.764	0.000	1032	0.540	0.573	Q6NXL1.pdb.gz	Q6NXL1_MOUSE Sec24 related gene family, member D (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24d PE=1 SV=1
4	AFDB:Q9VQ94	0.708	0.650	0.000	1193	0.482	0.442	Q9VQ94.pdb.gz	Q9VQ94_DROME LP05220p OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=2
5	AFDB:Q9M291	0.666	0.665	2.938E-87	1096	0.345	0.344	Q9M291.pdb.gz	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
6	AFDB:O95487	0.622	0.539	4.394E-75	1268	0.297	0.256	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
7	PDB:6zgaB	0.614	0.846	2.125E-57	786	0.186	0.260	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
8	PDB:1m2vA	0.516	0.780	1.316E-39	705	0.113	0.176	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
9	PDB:5kynA	0.520	0.759	5.410E-37	730	0.122	0.184	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
10	PDB:6zgaA	0.505	0.714	3.490E-30	751	0.111	0.161	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
11	PDB:6ujaB	0.157	0.393	1.838E-7	359	0.037	0.111	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
12	PDB:1u8cB	0.149	0.246	1.296E-6	599	0.039	0.072	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
13	PDB:4g1eB	0.144	0.206	4.142E-6	709	0.036	0.055	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:7nxdB	0.155	0.227	4.366E-6	690	0.034	0.054	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
15	PDB:6jp8F	0.130	0.144	5.993E-6	973	0.040	0.045	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
16	PDB:7ad8D	0.129	0.447	6.318E-6	280	0.027	0.107	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	AFDB:Q2UY11	0.133	0.128	1.329E-4	1141	0.122	0.117	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
18	AFDB:Q9TXR6	0.122	0.122	1.507E-3	1094	0.099	0.099	Q9TXR6.pdb.gz	Q9TXR6_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=2
19	AFDB:E7FCV8	0.121	0.130	2.555E-3	1015	0.105	0.113	E7FCV8.pdb.gz	E7FCV8_DANRE Collagen alpha-2(VI) chain isoform X4 OS=Danio rerio OX=7955 GN=col6a2 PE=1 SV=3
20	AFDB:Q586D9	0.059	0.041	8.961E-1	2060	0.128	0.068	Q586D9.pdb.gz	Q586D9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.170 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YDI8	0.0	1608	1020	0.764	0.820	A0A286YDI8_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
2	D5LMH4	0.0	1134	1029	0.501	0.533	D5LMH4_DANRE Protein transport protein Sec24D OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=1
3	E9PDM8	0.0	940	663	0.395	0.652	E9PDM8_HUMAN SEC24 homolog D, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=1
4	F1QRB4	0.0	1157	1030	0.507	0.539	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2
5	G3X972	0.0	1985	1096	0.918	0.916	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
6	M9PC99	0.0	927	1231	0.393	0.349	M9PC99_DROME Secretory 24CD, isoform C OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=1
7	O94855	0.0	1149	1032	0.524	0.555	SC24D_HUMAN Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2
8	P53992	0.0	2229	1094	1.000	1.000	SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3
9	Q3V222	0.0	1607	803	0.707	0.964	Q3V222_MOUSE Sec24c protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
10	Q6NXL1	0.0	1131	1032	0.514	0.545	Q6NXL1_MOUSE Sec24 related gene family, member D (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24d PE=1 SV=1
11	Q80U83	0.0	1609	1028	0.764	0.813	Q80U83_MOUSE MKIAA0079 protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
12	Q80V21	0.0	705	524	0.301	0.628	Q80V21_MOUSE Sec24d protein OS=Mus musculus OX=10090 GN=Sec24d PE=2 SV=1
13	Q8CGF4	0.0	1985	1096	0.917	0.915	Q8CGF4_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
14	Q8R0M3	0.0	556	434	0.235	0.592	Q8R0M3_MOUSE Sec24d protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24d PE=2 SV=1
15	Q8R2V9	0.0	877	436	0.384	0.963	Q8R2V9_MOUSE Sec24c protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
16	Q9VQ94	0.0	927	1193	0.393	0.360	Q9VQ94_DROME LP05220p OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=2
17	Q9M291	2.69e-168	526	1096	0.284	0.284	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
18	Q9SFU0	8.51e-138	444	1038	0.226	0.238	SC24A_ARATH Protein transport protein SEC24 A OS=Arabidopsis thaliana OX=3702 GN=SEC24A PE=1 SV=2
19	Q9USS7	1.36e-128	416	891	0.239	0.293	YNB3_SCHPO Uncharacterized protein C4.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4.03c PE=2 SV=1
20	O95487	9.35e-124	412	1268	0.214	0.185	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	9.3e-09	46.4	Gelsolin repeat
2	PF08033 Sec23_BS	4.3e-14	64.4	Sec23/Sec24 beta-sandwich domain
3	PF04815 Sec23_helical	3.7e-22	89.4	Sec23/Sec24 helical domain
4	PF04811 Sec23_trunk	3.9e-88	306.7	Sec23/Sec24 trunk domain
5	PF04810 zf-Sec23_Sec24	3.8e-10	50.9	Sec23/Sec24 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306881	0.998	Protein transport protein Sec23A
2	9606.ENSP00000378721	0.996	Protein transport protein Sec31A
3	9606.ENSP00000373312	0.995	Protein SEC13 homolog
4	9606.ENSP00000381823	0.995	Protein transport protein Sec24A
5	9606.ENSP00000338844	0.994	Protein transport protein Sec23B
6	9606.ENSP00000325827	0.991	Protein transport protein Sec16A
7	9606.ENSP00000280551	0.987	Protein transport protein Sec24D
8	9606.ENSP00000362339	0.986	GTP-binding protein SAR1a
9	9606.ENSP00000222547	0.972	BET1 homolog
10	9606.ENSP00000308339	0.969	Protein transport protein Sec16B
11	9606.ENSP00000428564	0.968	Protein transport protein Sec24B
12	9606.ENSP00000356230	0.958	Kelch-like protein 12
13	9606.ENSP00000359370	0.954	Protein transport protein Sec31B
14	9606.ENSP00000390783	0.951	Sec1 family domain-containing protein 1
15	9606.ENSP00000294179	0.946	Syntaxin-5
16	9606.ENSP00000362807	0.938	Peflin
17	9606.ENSP00000385432	0.929	GTP-binding protein SAR1b
18	9606.ENSP00000259400	0.925	Syntaxin-17
19	9606.ENSP00000260643	0.921	Prolactin regulatory element-binding protein
20	9606.ENSP00000264933	0.921	Programmed cell death protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008270	0.995	zinc ion binding
GO:0000149	0.994	SNARE binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.915	multicellular organismal process
GO:0001701	0.908	in utero embryonic development
GO:0009987	0.864	cellular process
GO:0051234	0.626	establishment of localization
GO:0006810	0.603	transport
GO:0051641	0.521	cellular localization
GO:0048193	0.491	Golgi vesicle transport
GO:0071840	0.463	cellular component organization or biogenesis
GO:0051649	0.460	establishment of localization in cell
GO:0046907	0.451	intracellular transport
GO:0016043	0.433	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0012507	0.996	ER to Golgi transport vesicle membrane
GO:0005829	0.994	cytosol
GO:0098796	0.990	membrane protein complex
GO:0030120	0.966	vesicle coat
GO:0030127	0.962	COPII vesicle coat
GO:0005794	0.300	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]