StarFunc result for job id P53999

User Input

>input (127 residues)
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRD
DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDI
DDAVRKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11031	0.892	0.892	3.050E-18	127	0.937	0.937	P11031.pdb.gz	TCP4_MOUSE Activated RNA polymerase II transcriptional coactivator p15 OS=Mus musculus OX=10090 GN=Sub1 PE=1 SV=3
2	AFDB:Q94045	0.470	0.482	8.215E-9	124	0.354	0.363	Q94045.pdb.gz	TCP4_CAEEL Putative RNA polymerase II transcriptional coactivator OS=Caenorhabditis elegans OX=6239 GN=T13F2.2 PE=3 SV=1
3	AFDB:O65154	0.500	0.589	6.440E-8	107	0.260	0.308	O65154.pdb.gz	KIWI_ARATH RNA polymerase II transcriptional coactivator KIWI OS=Arabidopsis thaliana OX=3702 GN=KIWI PE=1 SV=1
4	AFDB:Q9VLR5	0.489	0.561	4.186E-7	110	0.323	0.373	Q9VLR5.pdb.gz	TCP4_DROME RNA polymerase II transcriptional coactivator OS=Drosophila melanogaster OX=7227 GN=Ssb-c31a PE=2 SV=1
5	AFDB:P54000	0.547	0.247	4.483E-6	292	0.276	0.120	P54000.pdb.gz	SUB1_YEAST RNA polymerase II transcriptional coactivator SUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUB1 PE=1 SV=1
6	PDB:1gthA	0.169	0.029	1.061E-1	1019	0.047	0.006	1gthA.pdb.gz	Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer.
7	AFDB:Q9JK92	0.173	0.132	1.247E-1	196	0.110	0.071	Q9JK92.pdb.gz	HSPB8_MOUSE Heat shock protein beta-8 OS=Mus musculus OX=10090 GN=Hspb8 PE=1 SV=1
8	PDB:2iw3B	0.177	0.038	1.980E-1	980	0.102	0.013	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
9	AFDB:A0A2R8QT72	0.181	0.091	2.476E-1	336	0.157	0.060	A0A2R8QT72.pdb.gz
10	PDB:6f2rA	0.140	0.137	2.541E-1	130	0.055	0.054	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
11	AFDB:Q15723	0.189	0.062	2.636E-1	593	0.173	0.037	Q15723.pdb.gz	ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 PE=1 SV=2
12	AFDB:Q726E7	0.202	0.061	3.178E-1	510	0.157	0.039	Q726E7.pdb.gz	Q726E7_DESVH Phosphoribosylaminoimidazolecarboxamide formyltransferase, putative OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3206 PE=1 SV=1
13	AFDB:Q7ZVY3	0.218	0.104	3.178E-1	360	0.102	0.036	Q7ZVY3.pdb.gz	Q7ZVY3_DANRE Nfyc protein OS=Danio rerio OX=7955 GN=fb98f01 PE=1 SV=1
14	PDB:3ngyC	0.179	0.138	3.472E-1	182	0.087	0.060	3ngyC.pdb.gz	Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
15	PDB:3v9xB	0.157	0.099	3.933E-1	212	0.039	0.024	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
16	PDB:3pgwW	0.149	0.189	6.087E-1	92	0.008	0.011	3pgwW.pdb.gz
17	PDB:4g1eB	0.153	0.044	7.340E-1	709	0.055	0.010	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
18	PDB:6r8yK	0.140	0.028	8.852E-1	825	0.063	0.010	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
19	PDB:5n9jS	0.183	0.146	1.003	171	0.071	0.053	5n9jS.pdb.gz
20	PDB:6gvwC	0.207	0.076	1.067	383	0.031	0.010	6gvwC.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53999	8.87e-87	250	127	1.000	1.000	TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3
2	Q6IBA2	8.87e-87	250	127	1.000	1.000	Q6IBA2_HUMAN Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=PC4 PE=2 SV=1
3	P11031	1.50e-66	199	127	0.937	0.937	TCP4_MOUSE Activated RNA polymerase II transcriptional coactivator p15 OS=Mus musculus OX=10090 GN=Sub1 PE=1 SV=3
4	Q63396	2.11e-66	198	127	0.937	0.937	TCP4_RAT Activated RNA polymerase II transcriptional coactivator p15 OS=Rattus norvegicus OX=10116 GN=Sub1 PE=1 SV=3
5	Q94045	2.51e-15	68.9	124	0.244	0.250	TCP4_CAEEL Putative RNA polymerase II transcriptional coactivator OS=Caenorhabditis elegans OX=6239 GN=T13F2.2 PE=3 SV=1
6	P54000	7.99e-15	70.9	292	0.276	0.120	SUB1_YEAST RNA polymerase II transcriptional coactivator SUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUB1 PE=1 SV=1
7	O65154	1.18e-12	61.6	107	0.252	0.299	KIWI_ARATH RNA polymerase II transcriptional coactivator KIWI OS=Arabidopsis thaliana OX=3702 GN=KIWI PE=1 SV=1
8	O65155	8.34e-10	55.5	165	0.213	0.164	KELP_ARATH RNA polymerase II transcriptional coactivator KELP OS=Arabidopsis thaliana OX=3702 GN=KELP PE=1 SV=1
9	P87294	1.07e-09	54.7	136	0.165	0.154	TCP4_SCHPO Putative RNA polymerase II transcriptional coactivator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16A10.02 PE=1 SV=1
10	Q9VLR5	3.04e-07	47.8	110	0.213	0.245	TCP4_DROME RNA polymerase II transcriptional coactivator OS=Drosophila melanogaster OX=7227 GN=Ssb-c31a PE=2 SV=1
11	P78595	4.9	29.3	1499	0.110	0.009	CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDR2 PE=3 SV=2
12	Q9FR53	9.2	28.5	2481	0.110	0.006	TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana OX=3702 GN=TOR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02229 PC4	5.4e-21	85.2	Transcriptional Coactivator p15 (PC4)
2	PF08880 QLQ	2.3e+02	12.9	QLQ

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000034790

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000013920	0.795	General transcription factor IIB
2	9483.ENSCJAP00000026196	0.731	Transcription elongation factor SPT5
3	9483.ENSCJAP00000008115	0.705	Cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa
4	9483.ENSCJAP00000031167	0.680	SRA stem-loop interacting RNA binding protein
5	9483.ENSCJAP00000013169	0.649	Solute carrier family 35, member B1
6	9483.ENSCJAP00000029841	0.648	Uncharacterized protein
7	9483.ENSCJAP00000027663	0.633	Cellular tumor antigen p53
8	9483.ENSCJAP00000016823	0.618	Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA
9	9483.ENSCJAP00000018432	0.618	Uncharacterized protein
10	9483.ENSCJAP00000028860	0.606	Gamma-1-syntrophin
11	9483.ENSCJAP00000043085	0.606	Syntrophin, gamma 2
12	9483.ENSCJAP00000030687	0.604	Synapsin II
13	9483.ENSCJAP00000018682	0.599	CTD phosphatase subunit 1
14	9483.ENSCJAP00000033572	0.594	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at the specific target site 5'-[CT]CCTTp site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand thus removing DNA supercoil [...]
15	9483.ENSCJAP00000010292	0.593	Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
16	9483.ENSCJAP00000019165	0.591	LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)
17	9483.ENSCJAP00000035849	0.587	Small nuclear ribonucleoprotein polypeptide G
18	9483.ENSCJAP00000040933	0.587	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
19	9483.ENSCJAP00000041487	0.587	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
20	9483.ENSCJAP00000032138	0.580	CCHC-type zinc finger, nucleic acid binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003697	0.999	single-stranded DNA binding
GO:0042802	0.995	identical protein binding
GO:0003690	0.994	double-stranded DNA binding
GO:0043565	0.810	sequence-specific DNA binding
GO:1990837	0.781	sequence-specific double-stranded DNA binding
GO:0000976	0.767	transcription cis-regulatory region binding
GO:0000977	0.761	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.746	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.359	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.968	biological regulation
GO:0050789	0.936	regulation of biological process
GO:0050794	0.921	regulation of cellular process
GO:0071704	0.895	organic substance metabolic process
GO:0044238	0.853	primary metabolic process
GO:0044237	0.852	cellular metabolic process
GO:0006807	0.828	nitrogen compound metabolic process
GO:0043170	0.773	macromolecule metabolic process
GO:0019222	0.670	regulation of metabolic process
GO:0060255	0.642	regulation of macromolecule metabolic process
GO:0080090	0.569	regulation of primary metabolic process
GO:0051171	0.569	regulation of nitrogen compound metabolic process
GO:0031323	0.565	regulation of cellular metabolic process
GO:0010468	0.558	regulation of gene expression
GO:0019219	0.546	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.502	regulation of biosynthetic process
GO:0051252	0.501	regulation of RNA metabolic process
GO:0010556	0.494	regulation of macromolecule biosynthetic process
GO:0031326	0.494	regulation of cellular biosynthetic process
GO:1901360	0.479	organic cyclic compound metabolic process
GO:0034641	0.479	cellular nitrogen compound metabolic process
GO:0046483	0.465	heterocycle metabolic process
GO:0006725	0.465	cellular aromatic compound metabolic process
GO:0090304	0.456	nucleic acid metabolic process
GO:0010467	0.455	gene expression
GO:0016070	0.444	RNA metabolic process
GO:0006355	0.391	regulation of DNA-templated transcription
GO:0071840	0.379	cellular component organization or biogenesis
GO:0050896	0.361	response to stimulus
GO:0016043	0.331	cellular component organization
GO:0048519	0.329	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0032991	0.966	protein-containing complex
GO:0005730	0.739	nucleolus
GO:0005737	0.390	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]