StarFunc result for job id P54098

User Input

>input (1239 residues)
MSRLLWRKVAGATVGPGPVPAPGRWVSSSVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQ
VLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPL
PDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP
EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLS
PADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMA
ISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSLAEVH
RLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPH
PVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYK
EDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQ
QDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTP
KLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHC
LEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALT
ARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQ
AGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAI
LPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAA
VLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQP
FAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWI
SLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCIS
RALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYL
VREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTP
SNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5c51A	0.655	0.812	0.000	983	0.776	0.978	5c51A.pdb.gz	Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
2	AFDB:E5KNU5	0.887	0.887	0.000	1239	1.000	1.000	E5KNU5.pdb.gz	E5KNU5_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=3 SV=1
3	AFDB:P54099	0.926	0.941	0.000	1218	0.855	0.869	P54099.pdb.gz	DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus OX=10090 GN=Polg PE=1 SV=3
4	AFDB:Q91684	0.869	0.897	0.000	1200	0.640	0.661	Q91684.pdb.gz	DPOG1_XENLA DNA polymerase subunit gamma-1 OS=Xenopus laevis OX=8355 GN=polg PE=2 SV=1
5	AFDB:Q27607	0.770	0.832	6.795E-103	1145	0.419	0.453	Q27607.pdb.gz	DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PolG1 PE=1 SV=2
6	AFDB:Q92076	0.505	0.954	1.280E-80	647	0.401	0.768	Q92076.pdb.gz	DPOG1_CHICK DNA polymerase subunit gamma-1 (Fragment) OS=Gallus gallus OX=9031 GN=POLG PE=2 SV=1
7	AFDB:P15801	0.696	0.688	2.092E-79	1254	0.319	0.315	P15801.pdb.gz	DPOG_YEAST DNA polymerase gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIP1 PE=1 SV=3
8	AFDB:Q12704	0.676	0.815	1.139E-78	1018	0.329	0.401	Q12704.pdb.gz	DPOG_SCHPO DNA polymerase gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mip1 PE=3 SV=2
9	AFDB:Q9U208	0.661	0.759	1.062E-69	1072	0.278	0.322	Q9U208.pdb.gz	Q9U208_CAEEL DNA-directed DNA polymerase OS=Caenorhabditis elegans OX=6239 GN=polg-1 PE=1 SV=1
10	AFDB:F4JEQ3	0.294	0.336	2.970E-10	1049	0.137	0.162	F4JEQ3.pdb.gz	F4JEQ3_ARATH Polymerase gamma 1 OS=Arabidopsis thaliana OX=3702 GN=POLGAMMA1 PE=1 SV=1
11	AFDB:F4I6M1	0.296	0.338	6.387E-9	1050	0.125	0.148	F4I6M1.pdb.gz	POLIA_ARATH DNA polymerase I A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POLIA PE=2 SV=1
12	PDB:2ajqA	0.282	0.455	3.204E-8	704	0.098	0.172	2ajqA.pdb.gz	Structure of replicative DNA polymerase provides insigts into the mechanisms for processivity, frameshifting and editing
13	PDB:1sksA	0.266	0.445	5.810E-8	681	0.101	0.184	1sksA.pdb.gz	Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
14	PDB:6p7eC	0.185	0.322	1.266E-7	672	0.068	0.125	6p7eC.pdb.gz	Combined Solution and Crystal Methods Reveal the Electrostatic Tethers That Provide a Flexible Platform for Replication Activities in the Bacteriophage T7 Replisome.
15	PDB:6n9uH	0.187	0.337	4.504E-6	645	0.063	0.121	6n9uH.pdb.gz	Structures and operating principles of the replisome.
16	PDB:1s76D	0.110	0.155	3.403E-2	829	0.035	0.052	1s76D.pdb.gz	The structural mechanism of translocation and helicase activity in T7 RNA polymerase.
17	PDB:6ymvA	0.101	0.134	9.756E-2	887	0.030	0.042	6ymvA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
18	PDB:7lxdA	0.074	0.076	2.225E-1	1190	0.030	0.031	7lxdA.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
19	PDB:3k57A	0.092	0.136	6.677E-1	782	0.037	0.059	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
20	PDB:4uw2B	0.061	0.092	1.389	713	0.036	0.062	4uw2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GTU7	0.0	1874	910	0.734	0.999	A0A1B0GTU7_HUMAN DNA polymerase subunit gamma-1 (Fragment) OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1
2	A0A590UK63	0.0	564	286	0.217	0.941	A0A590UK63_HUMAN DNA polymerase gamma, catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1
3	E5KNU5	0.0	2559	1239	1.000	1.000	E5KNU5_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=3 SV=1
4	P54098	0.0	2559	1239	1.000	1.000	DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1
5	P54099	0.0	2107	1218	0.855	0.869	DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus OX=10090 GN=Polg PE=1 SV=3
6	Q27607	0.0	928	1145	0.431	0.466	DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PolG1 PE=1 SV=2
7	Q91684	0.0	1611	1200	0.637	0.657	DPOG1_XENLA DNA polymerase subunit gamma-1 OS=Xenopus laevis OX=8355 GN=polg PE=2 SV=1
8	Q92076	0.0	1030	647	0.402	0.770	DPOG1_CHICK DNA polymerase subunit gamma-1 (Fragment) OS=Gallus gallus OX=9031 GN=POLG PE=2 SV=1
9	Q9QYV8	0.0	2138	1216	0.856	0.872	DPOG1_RAT DNA polymerase subunit gamma-1 OS=Rattus norvegicus OX=10116 GN=Polg PE=2 SV=1
10	H0YCV2	3.78e-155	465	233	0.187	0.996	H0YCV2_HUMAN DNA polymerase gamma, catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=2
11	Q12704	9.98e-130	426	1018	0.187	0.228	DPOG_SCHPO DNA polymerase gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mip1 PE=3 SV=2
12	P15801	4.59e-126	421	1254	0.180	0.178	DPOG_YEAST DNA polymerase gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIP1 PE=1 SV=3
13	Q9U208	7.72e-83	296	1072	0.161	0.187	Q9U208_CAEEL DNA-directed DNA polymerase OS=Caenorhabditis elegans OX=6239 GN=polg-1 PE=1 SV=1
14	P19822	0.28	37.7	855	0.023	0.034	DPOL_BPT5 DNA polymerase OS=Escherichia phage T5 OX=2695836 GN=T5.122 PE=1 SV=3
15	A0A8I6ANK4	2.3	35.0	1589	0.021	0.016	A0A8I6ANK4_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
16	A0A8I6APB3	2.4	35.0	1610	0.021	0.016	A0A8I6APB3_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
17	D3ZWS0	2.4	35.0	1638	0.021	0.016	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
18	A0A8I6ABB5	2.5	35.0	1589	0.021	0.016	A0A8I6ABB5_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
19	Q8SXR2	8.5	32.7	390	0.018	0.056	Q8SXR2_DROME RE65257p OS=Drosophila melanogaster OX=7227 GN=kin17 PE=2 SV=1
20	Q9VPH4	8.7	32.7	390	0.018	0.056	Q9VPH4_DROME FI03293p OS=Drosophila melanogaster OX=7227 GN=kin17 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18136 DNApol_Exo	2.3e-99	343.7	DNA mitochondrial polymerase exonuclease domain
2	PF00476 DNA_pol_A	3.7e-23	93.7	DNA polymerase family A
3	PF01612 DNA_pol_A_exo1	1.2e+02	13.9	3'-5' exonuclease
4	PF10846 DUF2722	25	15.3	Protein of unknown function (DUF2722)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442563	0.999	DNA polymerase subunit gamma-2, mitochondrial
2	9606.ENSP00000309595	0.971	Twinkle protein, mitochondrial
3	9606.ENSP00000446252	0.956	Superoxide dismutase [Mn], mitochondrial
4	9606.ENSP00000351697	0.952	DNA polymerase zeta catalytic subunit
5	9606.ENSP00000322570	0.942	DNA polymerase epsilon catalytic subunit A
6	9606.ENSP00000406046	0.939	DNA polymerase delta catalytic subunit
7	9606.ENSP00000419665	0.932	Single-stranded DNA-binding protein, mitochondrial
8	9606.ENSP00000368349	0.926	DNA polymerase alpha catalytic subunit
9	9606.ENSP00000420588	0.926	Transcription factor A, mitochondrial
10	9606.ENSP00000235310	0.924	Mitotic spindle assembly checkpoint protein MAD2B
11	9606.ENSP00000265465	0.918	DNA polymerase alpha subunit B
12	9606.ENSP00000216367	0.914	DNA polymerase epsilon subunit 2
13	9606.ENSP00000263681	0.914	DNA polymerase delta subunit 3
14	9606.ENSP00000480186	0.914	DNA polymerase delta subunit 2
15	9606.ENSP00000420176	0.910	DNA polymerase epsilon subunit 4
16	9606.ENSP00000363286	0.909	DNA polymerase epsilon subunit 3
17	9606.ENSP00000220913	0.906	Chromatin accessibility complex protein 1
18	9606.ENSP00000269305	0.904	Cellular tumor antigen p53
19	9606.ENSP00000378736	0.900	DNA-directed RNA polymerase III subunit RPC9
20	9606.ENSP00000264093	0.859	Deoxyguanosine kinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004527	1.000	exonuclease activity
GO:0003887	1.000	DNA-directed DNA polymerase activity
GO:0008408	0.994	3'-5' exonuclease activity
GO:0003676	0.976	nucleic acid binding
GO:0003677	0.912	DNA binding
GO:0003682	0.847	chromatin binding
GO:0019899	0.815	enzyme binding
GO:0002020	0.739	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006260	0.998	DNA replication
GO:0051716	0.975	cellular response to stimulus
GO:0006996	0.965	organelle organization
GO:0006261	0.960	DNA-templated DNA replication
GO:0006950	0.958	response to stress
GO:0032042	0.930	mitochondrial DNA metabolic process
GO:0033554	0.882	cellular response to stress
GO:0006281	0.757	DNA repair
GO:0006284	0.441	base-excision repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.991	intracellular organelle lumen
GO:0032991	0.967	protein-containing complex
GO:1902494	0.797	catalytic complex
GO:0005634	0.751	nucleus
GO:0043232	0.661	intracellular non-membrane-bounded organelle
GO:0005759	0.595	mitochondrial matrix
GO:0042575	0.549	DNA polymerase complex
GO:0098798	0.519	mitochondrial protein-containing complex
GO:0031981	0.475	nuclear lumen
GO:0005654	0.343	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.
EC:2.7.7.7	1.000	DNA-directed DNA polymerase.

[back to server]