StarFunc result for job id P54132

User Input

>input (1417 residues)
MAAVPQNNLQEQLERHSARTLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVL
RNKDVNVTEDFSFSEPLPNTTNQQRVKDFFKNAPAGQETQRGGSKSLLPDFLQTPKEVVC
TTQNTPTVKKSRDTALKKLEFSSSPDSLSTINDWDDMDDFDTSETSKSFVTPPQSHFVRV
STAQKSKKGKRNFFKAQLYTTNTVKTDLPPPSSESEQIDLTEEQKDDSEWLSSDVICIDD
GPIAEVHINEDAQESDSLKTHLEDERDNSEKKKNLEEAELHSTEKVPCIEFDDDDYDTDF
VPPSPEEIISASSSSSKCLSTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTD
CDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSD
ASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGDCLLTTTLGKTGFS
ATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASI
NDLERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERL
SSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFH
KKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLI
VDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTL
ENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKD
ILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRE
CDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRF
VIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHF
NNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDD
VKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRH
NAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKK
QKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVL
LQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIP
VSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSS
SASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88700	0.548	0.548	0.000	1416	0.767	0.768	O88700.pdb.gz	BLM_MOUSE RecQ-like DNA helicase BLM OS=Mus musculus OX=10090 GN=Blm PE=1 SV=1
2	AFDB:P54132	1.000	1.000	0.000	1417	1.000	1.000	P54132.pdb.gz	BLM_HUMAN RecQ-like DNA helicase BLM OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1
3	PDB:7pliA	0.205	0.586	7.937E-15	457	0.047	0.147	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
4	AFDB:O76743	0.201	0.242	3.129E-14	1156	0.107	0.131	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
5	PDB:5dcaA	0.193	0.145	9.626E-14	1948	0.078	0.056	5dcaA.pdb.gz
6	AFDB:B0R0I6	0.183	0.109	1.624E-13	2511	0.145	0.082	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
7	PDB:7evoE	0.112	0.313	4.093E-13	455	0.056	0.176	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
8	PDB:3ex7C	0.204	0.667	4.754E-13	392	0.047	0.168	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
9	AFDB:Q54Q16	0.201	0.153	1.196E-12	1917	0.132	0.098	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
10	PDB:7v2yF	0.182	0.546	1.645E-11	376	0.052	0.194	7v2yF.pdb.gz
11	PDB:5zwny	0.118	0.370	2.452E-11	399	0.056	0.198	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
12	PDB:2eyqA	0.180	0.216	2.577E-11	1146	0.053	0.065	2eyqA.pdb.gz
13	PDB:6qw65B	0.192	0.140	4.931E-11	2001	0.077	0.054	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:6qw65X	0.129	0.259	4.931E-11	583	0.056	0.137	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:7oqbp	0.108	0.301	5.448E-11	444	0.054	0.171	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
16	AFDB:F4HTG1	0.184	0.201	1.141E-5	1280	0.100	0.111	F4HTG1.pdb.gz	F4HTG1_ARATH SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=EDA16 PE=1 SV=1
17	AFDB:Q54RP6	0.048	0.044	1.519E-3	1709	0.120	0.099	Q54RP6.pdb.gz	DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum OX=44689 GN=dhkL PE=3 SV=1
18	AFDB:P46889	0.089	0.094	1.678E-3	1329	0.092	0.098	P46889.pdb.gz	FTSK_ECOLI DNA translocase FtsK OS=Escherichia coli (strain K12) OX=83333 GN=ftsK PE=1 SV=2
19	AFDB:X2JAX8	0.046	0.049	2.764E-3	1330	0.116	0.124	X2JAX8.pdb.gz	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
20	AFDB:Q9VMA7	0.028	0.027	3.211E-3	1430	0.068	0.068	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IT82	0.0	2830	1386	0.959	0.981	A0A3B3IT82_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1
2	E7EZY7	0.0	1082	1420	0.367	0.366	E7EZY7_DANRE DNA helicase OS=Danio rerio OX=7955 GN=blm PE=3 SV=3
3	H0YNU5	0.0	2352	1286	0.791	0.872	H0YNU5_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1
4	O88700	0.0	2120	1416	0.767	0.768	BLM_MOUSE RecQ-like DNA helicase BLM OS=Mus musculus OX=10090 GN=Blm PE=1 SV=1
5	P54132	0.0	2944	1417	1.000	1.000	BLM_HUMAN RecQ-like DNA helicase BLM OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1
6	Q9I920	0.0	1297	1183	0.483	0.578	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2
7	Q9VGI8	0.0	582	1487	0.219	0.209	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
8	O18017	1.26e-148	479	988	0.194	0.278	BLM_CAEEL RecQ-like DNA helicase blm-1 OS=Caenorhabditis elegans OX=6239 GN=him-6 PE=1 SV=2
9	Q09811	1.40e-145	480	1328	0.183	0.195	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
10	Q54DM3	8.94e-145	476	1259	0.198	0.222	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
11	Q8L840	1.38e-138	458	1188	0.189	0.226	RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana OX=3702 GN=RECQL4A PE=2 SV=1
12	Q9FT70	3.26e-133	442	1150	0.192	0.237	RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana OX=3702 GN=RECQL4B PE=2 SV=1
13	Q6FLV3	2.71e-130	439	1371	0.168	0.174	Q6FLV3_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0L00407g PE=3 SV=1
14	P35187	1.46e-128	436	1447	0.156	0.153	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1
15	Q5A5R4	3.19e-128	429	1189	0.178	0.212	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
16	Q57TU4	8.73e-118	407	1548	0.160	0.147	Q57TU4_TRYB2 ATP-dependent DEAD/H DNA helicase recQ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.580 PE=3 SV=1
17	P46063	5.02e-117	383	649	0.146	0.319	RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3
18	Q9FT73	1.30e-116	384	705	0.158	0.318	RECQ2_ARATH ATP-dependent DNA helicase Q-like 2 OS=Arabidopsis thaliana OX=3702 GN=RECQL2 PE=1 SV=1
19	Q9FT74	4.42e-116	379	606	0.143	0.333	RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana OX=3702 GN=RECQL1 PE=2 SV=1
20	P15043	8.20e-102	340	609	0.157	0.365	RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) OX=83333 GN=recQ PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08072 BDHCT	1.6e-18	77.7	BDHCT (NUC031) domain
2	PF16204 BDHCT_assoc	7.4e-120	410.2	BDHCT-box associated domain on Bloom syndrome protein
3	PF16202 BLM_N	1.6e-164	559.1	N-terminal region of Bloom syndrome protein
4	PF00270 DEAD	3e-16	71.2	DEAD/DEAH box helicase
5	PF00271 Helicase_C	1.1e-11	56.4	Helicase conserved C-terminal domain
6	PF00570 HRDC	1.2e-08	46.1	HRDC domain
7	PF16124 RecQ_Zn_bind	8e-14	63.4	RecQ zinc-binding
8	PF04851 ResIII	1.6	20.2	Type III restriction enzyme, res subunit
9	PF09382 RQC	1.5e-12	58.8	RQC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347232

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267430	0.999	Fanconi anemia group M protein
2	9606.ENSP00000308583	0.999	Centromere protein S
3	9606.ENSP00000317039	0.999	RecQ-mediated genome instability protein 1
4	9606.ENSP00000355506	0.999	Exonuclease 1
5	9606.ENSP00000372088	0.999	DNA repair protein RAD51 homolog 1
6	9606.ENSP00000373952	0.999	Fanconi anemia group A protein
7	9606.ENSP00000442336	0.999	DNA topoisomerase 3-alpha
8	9606.ENSP00000307853	0.998	Crossover junction endonuclease MUS81
9	9606.ENSP00000254719	0.997	Replication protein A 70 kDa DNA-binding subunit
10	9606.ENSP00000278616	0.997	Serine-protein kinase ATM
11	9606.ENSP00000231790	0.995	DNA mismatch repair protein Mlh1
12	9606.ENSP00000343741	0.995	Serine/threonine-protein kinase ATR
13	9606.ENSP00000388648	0.993	Serine/threonine-protein kinase Chk1
14	9606.ENSP00000269305	0.992	Cellular tumor antigen p53
15	9606.ENSP00000325863	0.992	Double-strand break repair protein MRE11
16	9606.ENSP00000451974	0.992	DNA repair protein XRCC3
17	9606.ENSP00000351284	0.991	DNA repair protein RAD52 homolog
18	9606.ENSP00000310356	0.990	RecQ-mediated genome instability protein 2
19	9606.ENSP00000333283	0.990	Fanconi anemia core complex-associated protein 100
20	9606.ENSP00000351185	0.989	DNA replication ATP-dependent helicase/nuclease DNA2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043138	0.999	3'-5' DNA helicase activity
GO:0003676	0.998	nucleic acid binding
GO:0003677	0.991	DNA binding
GO:0003697	0.964	single-stranded DNA binding
GO:0140666	0.958	annealing activity
GO:0046872	0.950	metal ion binding
GO:0035639	0.929	purine ribonucleoside triphosphate binding
GO:0032555	0.926	purine ribonucleotide binding
GO:1990814	0.898	DNA/DNA annealing activity
GO:0000217	0.846	DNA secondary structure binding
GO:0003684	0.815	damaged DNA binding
GO:0042802	0.788	identical protein binding
GO:0000400	0.777	four-way junction DNA binding
GO:0042162	0.776	telomeric DNA binding
GO:0002039	0.771	p53 binding
GO:0032559	0.758	adenyl ribonucleotide binding
GO:0005524	0.742	ATP binding
GO:0008270	0.727	zinc ion binding
GO:0098772	0.718	molecular function regulator activity
GO:0140677	0.704	molecular function activator activity
GO:0046983	0.665	protein dimerization activity
GO:0042803	0.657	protein homodimerization activity
GO:0000403	0.355	Y-form DNA binding
GO:0009378	0.354	four-way junction helicase activity
GO:0061821	0.343	telomeric D-loop binding
GO:1905773	0.341	8-hydroxy-2'-deoxyguanosine DNA binding
GO:0061749	0.340	forked DNA-dependent helicase activity
GO:0061849	0.340	telomeric G-quadruplex DNA binding
GO:0000405	0.329	bubble DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0006974	0.991	cellular response to DNA damage stimulus
GO:0006259	0.991	DNA metabolic process
GO:0019222	0.957	regulation of metabolic process
GO:0010605	0.947	negative regulation of macromolecule metabolic process
GO:0016043	0.946	cellular component organization
GO:0006281	0.942	DNA repair
GO:0051172	0.935	negative regulation of nitrogen compound metabolic process
GO:0019219	0.935	regulation of nucleobase-containing compound metabolic process
GO:0051053	0.933	negative regulation of DNA metabolic process
GO:0051276	0.931	chromosome organization
GO:0006260	0.927	DNA replication
GO:0000018	0.924	regulation of DNA recombination
GO:0032392	0.904	DNA geometric change
GO:0045910	0.897	negative regulation of DNA recombination
GO:0048522	0.888	positive regulation of cellular process
GO:0006302	0.876	double-strand break repair
GO:1901987	0.865	regulation of cell cycle phase transition
GO:1901988	0.848	negative regulation of cell cycle phase transition
GO:0010604	0.846	positive regulation of macromolecule metabolic process
GO:0051173	0.844	positive regulation of nitrogen compound metabolic process
GO:0031325	0.839	positive regulation of cellular metabolic process
GO:0007346	0.835	regulation of mitotic cell cycle
GO:0000278	0.825	mitotic cell cycle
GO:1903047	0.824	mitotic cell cycle process
GO:0000723	0.818	telomere maintenance
GO:0000075	0.817	cell cycle checkpoint signaling
GO:0045935	0.816	positive regulation of nucleobase-containing compound metabolic process
GO:0031570	0.802	DNA integrity checkpoint signaling
GO:0042770	0.798	signal transduction in response to DNA damage
GO:0000077	0.792	DNA damage checkpoint signaling
GO:0045930	0.781	negative regulation of mitotic cell cycle
GO:0007093	0.758	mitotic cell cycle checkpoint signaling
GO:0000724	0.741	double-strand break repair via homologous recombination
GO:1901990	0.737	regulation of mitotic cell cycle phase transition
GO:0044774	0.701	mitotic DNA integrity checkpoint signaling
GO:0044773	0.672	mitotic DNA damage checkpoint signaling
GO:0006261	0.649	DNA-templated DNA replication
GO:1902749	0.634	regulation of cell cycle G2/M phase transition
GO:0031297	0.607	replication fork processing
GO:1901991	0.561	negative regulation of mitotic cell cycle phase transition
GO:0010389	0.534	regulation of G2/M transition of mitotic cell cycle
GO:0010972	0.493	negative regulation of G2/M transition of mitotic cell cycle
GO:0065009	0.412	regulation of molecular function
GO:0044818	0.398	mitotic G2/M transition checkpoint
GO:0032508	0.374	DNA duplex unwinding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.996	cytosol
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0005694	0.955	chromosome
GO:0032991	0.920	protein-containing complex
GO:0000781	0.493	chromosome, telomeric region
GO:0016605	0.386	PML body
GO:0005730	0.386	nucleolus
GO:0031422	0.380	RecQ family helicase-topoisomerase III complex
GO:0034399	0.376	nuclear periphery
GO:0000793	0.374	condensed chromosome
GO:0016363	0.374	nuclear matrix
GO:0000228	0.368	nuclear chromosome
GO:0000800	0.361	lateral element

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.4	0.999	DNA 3'-5' helicase.

[back to server]