StarFunc result for job id P54136

User Input

>input (660 residues)
MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRK
SLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMG
ISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLV
NGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGD
WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK
NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDG
RKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEK
ERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTR
IRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY
IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40329	0.913	0.913	5.249E-96	660	0.915	0.915	P40329.pdb.gz	SYRC_RAT Arginine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Rars1 PE=1 SV=2
2	PDB:4r3zB	0.903	0.904	1.894E-87	659	0.997	0.998	4r3zB.pdb.gz
3	AFDB:Q9VXN4	0.884	0.878	4.980E-71	665	0.576	0.571	Q9VXN4.pdb.gz	SYRC_DROME Probable arginine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ArgRS PE=2 SV=1
4	AFDB:Q19825	0.870	0.807	2.264E-67	713	0.518	0.480	Q19825.pdb.gz	SYRC_CAEEL Probable arginine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=rars-1 PE=3 SV=2
5	AFDB:O23247	0.858	0.882	1.304E-57	642	0.426	0.438	O23247.pdb.gz	SYRM_ARATH Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1027 PE=1 SV=1
6	AFDB:Q9C713	0.851	0.950	5.519E-57	590	0.415	0.464	Q9C713.pdb.gz	SYRC_ARATH Arginine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g66530 PE=1 SV=1
7	AFDB:Q386W0	0.825	0.788	2.757E-51	692	0.373	0.355	Q386W0.pdb.gz	Q386W0_TRYB2 arginine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0008 PE=3 SV=1
8	AFDB:P11875	0.822	0.937	1.816E-49	577	0.345	0.395	P11875.pdb.gz	SYR_ECOLI Arginine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=argS PE=1 SV=1
9	PDB:5yymA	0.809	0.915	6.687E-46	581	0.345	0.392	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
10	PDB:5b63C	0.784	0.931	1.513E-42	553	0.327	0.391	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
11	AFDB:Q54869	0.746	0.865	1.629E-38	563	0.248	0.291	Q54869.pdb.gz	SYR_STRPN Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=argS PE=1 SV=2
12	AFDB:Q5T160	0.733	0.829	4.757E-36	578	0.235	0.268	Q5T160.pdb.gz	SYRM_HUMAN Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=RARS2 PE=1 SV=1
13	AFDB:Q3U186	0.726	0.821	1.671E-35	578	0.244	0.279	Q3U186.pdb.gz	SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Rars2 PE=1 SV=1
14	PDB:1f7uA	0.746	0.808	6.444E-32	606	0.241	0.262	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
15	PDB:1li7B	0.374	0.614	1.145E-7	375	0.091	0.160	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
16	PDB:1u0bB	0.384	0.525	4.414E-7	461	0.089	0.128	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:6ax8A	0.405	0.512	1.913E-5	509	0.085	0.110	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
18	PDB:4a91A	0.216	0.461	1.203E-3	290	0.044	0.100	4a91A.pdb.gz	Crystal Structure of Glutamyl-Queuosine Trnaasp Synthetase Complexed with L-Glutamate: Structural Elements Mediating tRNA-Independent Activation of Glutamate and Glutamylation of Trnaasp Anticodon.
19	PDB:2ja2A	0.260	0.337	4.426E-3	485	0.098	0.134	2ja2A.pdb.gz
20	PDB:2janA	0.190	0.276	1.291E-2	419	0.086	0.136	2janA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O23247	0.0	543	642	0.429	0.441	SYRM_ARATH Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1027 PE=1 SV=1
2	P40329	0.0	1267	660	0.915	0.915	SYRC_RAT Arginine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Rars1 PE=1 SV=2
3	P54136	0.0	1367	660	1.000	1.000	SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2
4	Q19825	0.0	644	713	0.508	0.470	SYRC_CAEEL Probable arginine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=rars-1 PE=3 SV=2
5	Q9D0I9	0.0	1263	660	0.915	0.915	SYRC_MOUSE Arginine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Rars1 PE=1 SV=2
6	Q9VXN4	0.0	736	665	0.574	0.570	SYRC_DROME Probable arginine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ArgRS PE=2 SV=1
7	Q9C713	3.52e-180	526	590	0.417	0.466	SYRC_ARATH Arginine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g66530 PE=1 SV=1
8	P11875	9.15e-130	396	577	0.352	0.402	SYR_ECOLI Arginine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=argS PE=1 SV=1
9	Q386W0	1.20e-75	258	692	0.202	0.192	Q386W0_TRYB2 arginine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0008 PE=3 SV=1
10	Q54869	4.37e-69	237	563	0.247	0.290	SYR_STRPN Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=argS PE=1 SV=2
11	Q3U186	7.54e-58	207	578	0.256	0.292	SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Rars2 PE=1 SV=1
12	Q5T160	2.02e-56	203	578	0.236	0.270	SYRM_HUMAN Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=RARS2 PE=1 SV=1
13	Q05506	2.67e-54	197	607	0.235	0.255	SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR341C PE=1 SV=1
14	O74781	9.25e-52	191	618	0.238	0.254	SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrs1 PE=2 SV=1
15	Q558Z0	3.96e-51	189	589	0.232	0.260	SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=argS1 PE=3 SV=1
16	Q6PGW8	1.81e-46	176	597	0.238	0.263	Q6PGW8_DANRE arginine--tRNA ligase OS=Danio rerio OX=7955 GN=zgc:63702 PE=1 SV=1
17	Q8SXK2	6.74e-46	174	594	0.209	0.232	Q8SXK2_DROME arginine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ArgRS-m PE=2 SV=1
18	P38714	3.25e-44	170	643	0.226	0.232	SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSR1 PE=3 SV=3
19	O51540	4.36e-34	139	585	0.200	0.226	SYR_BORBU Arginine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=argS PE=3 SV=2
20	P9WFW5	2.64e-27	119	550	0.224	0.269	SYR_MYCTU Arginine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03485 Arg_tRNA_synt_N	1.3e-20	85.0	Arginyl tRNA synthetase N terminal domain
2	PF05746 DALR_1	7e-29	111.8	DALR anticodon binding domain
3	PF00750 tRNA-synt_1d	1.1e-166	565.7	tRNA synthetases class I (R)
4	PF01406 tRNA-synt_1e	1.2	20.0	tRNA synthetases class I (C) catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223029	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
2	9606.ENSP00000262027	0.999	Methionine--tRNA ligase, cytoplasmic
3	9606.ENSP00000264161	0.999	Aspartate--tRNA ligase, cytoplasmic
4	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
5	9606.ENSP00000325448	0.999	Lysine--tRNA ligase
6	9606.ENSP00000355890	0.999	Bifunctional glutamate/proline--tRNA ligase
7	9606.ENSP00000364794	0.999	Isoleucine--tRNA ligase, cytoplasmic
8	9606.ENSP00000377954	0.999	Leucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000378191	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
10	9606.ENSP00000369038	0.996	Eukaryotic translation elongation factor 1 epsilon-1
11	9606.ENSP00000224356	0.958	Cytochrome P450 26A1
12	9606.ENSP00000268712	0.956	Nuclear receptor corepressor 1
13	9606.ENSP00000482841	0.944	Cellular retinoic acid-binding protein 2
14	9606.ENSP00000256854	0.937	Asparagine--tRNA ligase, cytoplasmic
15	9606.ENSP00000384018	0.935	Nuclear receptor corepressor 2
16	9606.ENSP00000419692	0.934	Retinoic acid receptor RXR-alpha
17	9606.ENSP00000338093	0.932	Probable threonine--tRNA ligase 2, cytoplasmic
18	9606.ENSP00000362576	0.925	Tyrosine--tRNA ligase, cytoplasmic
19	9606.ENSP00000408576	0.925	Probable leucine--tRNA ligase, mitochondrial
20	9606.ENSP00000472847	0.923	Serine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004814	0.999	arginine-tRNA ligase activity
GO:0005488	0.997	binding
GO:0005515	0.987	protein binding
GO:0003676	0.945	nucleic acid binding
GO:0003723	0.906	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006412	0.998	translation
GO:0006418	0.991	tRNA aminoacylation for protein translation
GO:0006420	0.440	arginyl-tRNA aminoacylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:1902494	0.995	catalytic complex
GO:0140535	0.990	intracellular protein-containing complex
GO:0043226	0.990	organelle
GO:0017101	0.984	aminoacyl-tRNA synthetase multienzyme complex
GO:0043227	0.982	membrane-bounded organelle
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005829	0.954	cytosol
GO:0005654	0.882	nucleoplasm
GO:0016020	0.568	membrane
GO:0043230	0.392	extracellular organelle
GO:0065010	0.374	extracellular membrane-bounded organelle
GO:0031982	0.365	vesicle
GO:1903561	0.322	extracellular vesicle
GO:0043232	0.321	intracellular non-membrane-bounded organelle
GO:0070062	0.302	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20301	0.999	ATP + L-arginine + tRNA(Arg) = AMP + diphosphate + L-arginyl-tRNA(Arg)
EC:6.1.1.19	0.999	arginine--tRNA ligase.

[back to server]