StarFunc result for job id P54198

User Input

>input (1017 residues)
MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIP
KMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQ
WRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGL
TWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSA
HAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCC
AVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQD
ELGDPLSEEEKSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAAT
REMGSATSVAGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFN
SIPLSGSLAGTMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDSMN
ATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVK
ELRPRDLLESSSDSDEKVPLAKASSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQ
SPAALTAEKEAMCLSAPALALKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSR
LKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTL
HCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPVMNLS
DGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQA
ARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICK
DLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54198	1.000	1.000	0.000	1017	1.000	1.000	P54198.pdb.gz	HIRA_HUMAN Protein HIRA OS=Homo sapiens OX=9606 GN=HIRA PE=1 SV=2
2	AFDB:P79987	0.431	0.430	0.000	1019	0.857	0.856	P79987.pdb.gz	HIRA_CHICK Protein HIRA OS=Gallus gallus OX=9031 GN=HIRA PE=1 SV=2
3	AFDB:Q8QFR2	0.490	0.492	0.000	1013	0.781	0.784	Q8QFR2.pdb.gz	HIRA_XENLA Protein HIRA OS=Xenopus laevis OX=8355 GN=hira PE=1 SV=2
4	AFDB:A1Z898	0.328	0.439	4.927E-31	747	0.153	0.209	A1Z898.pdb.gz	A1Z898_DROME Chromatin assembly factor 1, p105 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-105 PE=1 SV=1
5	AFDB:U4PCM1	0.268	0.335	1.241E-18	809	0.093	0.117	U4PCM1.pdb.gz	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
6	PDB:7zgrD	0.253	0.626	7.927E-17	395	0.066	0.170	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
7	PDB:2h9lA	0.250	0.754	1.985E-16	321	0.073	0.231	2h9lA.pdb.gz
8	PDB:3jcmB	0.267	0.611	4.971E-16	429	0.056	0.133	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
9	PDB:5mzhB	0.253	0.579	8.458E-16	415	0.064	0.157	5mzhB.pdb.gz
10	PDB:6tblF	0.254	0.733	1.077E-15	336	0.079	0.238	6tblF.pdb.gz
11	PDB:5jcsq	0.241	0.474	1.186E-15	488	0.073	0.152	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
12	PDB:7jvrB	0.264	0.740	1.510E-15	342	0.058	0.173	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
13	PDB:7bt6x	0.235	0.453	1.664E-15	488	0.072	0.150	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:5nnzA	0.246	0.676	4.372E-15	335	0.067	0.203	5nnzA.pdb.gz
15	PDB:7mq8LU	0.260	0.570	4.816E-15	445	0.061	0.139	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	AFDB:Q389F7	0.257	0.238	1.636E-13	1105	0.114	0.105	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
17	AFDB:Q8I5B3	0.193	0.231	2.259E-11	822	0.101	0.125	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
18	AFDB:P16371	0.265	0.365	6.038E-10	730	0.053	0.074	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
19	AFDB:K7EMK7	0.260	0.352	1.131E-9	744	0.054	0.074	K7EMK7.pdb.gz	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
20	AFDB:H0YL70	0.261	0.337	1.188E-9	782	0.055	0.072	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O17468	0.0	560	1047	0.271	0.264	HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster OX=7227 GN=Hira PE=1 SV=2
2	P54198	0.0	2100	1017	1.000	1.000	HIRA_HUMAN Protein HIRA OS=Homo sapiens OX=9606 GN=HIRA PE=1 SV=2
3	P79987	0.0	1805	1019	0.861	0.860	HIRA_CHICK Protein HIRA OS=Gallus gallus OX=9031 GN=HIRA PE=1 SV=2
4	Q61666	0.0	1962	1015	0.958	0.960	HIRA_MOUSE Protein HIRA OS=Mus musculus OX=10090 GN=Hira PE=1 SV=3
5	Q8QFR2	0.0	1649	1013	0.782	0.785	HIRA_XENLA Protein HIRA OS=Xenopus laevis OX=8355 GN=hira PE=1 SV=2
6	Q32SG6	7.90e-96	327	964	0.184	0.194	HIRA_MAIZE Protein HIRA OS=Zea mays OX=4577 PE=1 SV=1
7	Q9LXN4	3.83e-91	315	1024	0.181	0.180	HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana OX=3702 GN=HIRA PE=1 SV=2
8	P87314	1.75e-81	286	932	0.173	0.189	HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hip1 PE=1 SV=1
9	P32479	4.37e-62	229	840	0.130	0.157	HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HIR1 PE=1 SV=3
10	Q5ACW8	7.29e-62	229	907	0.145	0.162	HIR1_CANAL Protein HIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HIR1 PE=3 SV=2
11	Q5R1S9	2.25e-44	172	566	0.128	0.230	CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus OX=9031 GN=CHAF1B PE=1 SV=1
12	Q9SXY1	3.20e-40	158	487	0.134	0.279	FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana OX=3702 GN=FAS2 PE=1 SV=1
13	Q9D0N7	2.10e-38	154	572	0.116	0.206	CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus OX=10090 GN=Chaf1b PE=1 SV=1
14	Q13112	6.18e-38	152	559	0.114	0.208	CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1
15	A1Z898	8.90e-37	151	747	0.102	0.139	A1Z898_DROME Chromatin assembly factor 1, p105 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-105 PE=1 SV=1
16	E7EYR2	1.20e-36	149	613	0.109	0.181	E7EYR2_DANRE Chromatin assembly factor 1 subunit B OS=Danio rerio OX=7955 GN=fe36g06 PE=1 SV=1
17	Q9BII5	2.97e-36	149	747	0.105	0.143	Q9BII5_DROME Chromatin assembly factor-1 p105 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-105 PE=2 SV=1
18	O74309	1.54e-34	144	807	0.065	0.082	SLM9_SCHPO Histone transcription regulator slm9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slm9 PE=1 SV=1
19	A0A1D8PNS7	6.50e-31	129	460	0.104	0.230	A0A1D8PNS7_CANAL Cac2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAC2 PE=4 SV=1
20	Q04199	3.52e-19	94.4	468	0.092	0.201	CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.6e-06	39.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF07569 Hira	3.5e-52	188.8	TUP1-like enhancer of split
3	PF09453 HIRA_B	2	19.7	HIRA B motif
4	PF12341 Mcl1_mid	9.9	17.0	Minichromosome loss protein, Mcl1, middle region
5	PF20426 NBCH_WD40	6.4	17.1	Neurobeachin beta propeller domain
6	PF00400 WD40	5.7e-24	95.1	WD domain, G-beta repeat
7	PF17005 WD40_like	3.7e+02	11.8	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229595	0.999	Histone chaperone ASF1A
2	9606.ENSP00000379894	0.997	Ubinuclein-1
3	9606.ENSP00000381364	0.990	Calcineurin-binding protein cabin-1
4	9606.ENSP00000263382	0.984	Histone chaperone ASF1B
5	9606.ENSP00000254810	0.957	H3 histone, family 3B (H3.3B)
6	9606.ENSP00000269305	0.926	Cellular tumor antigen p53
7	9606.ENSP00000374213	0.924	E1A-binding protein p400
8	9606.ENSP00000261366	0.908	Lamin-B1
9	9606.ENSP00000267163	0.902	Retinoblastoma-associated protein
10	9606.ENSP00000369424	0.827	Histone-binding protein RBBP7
11	9606.ENSP00000362592	0.793	Histone-binding protein RBBP4
12	9606.ENSP00000245787	0.785	Insulin-induced gene 2 protein
13	9606.ENSP00000344741	0.785	Insulin-induced gene 1 protein
14	9606.ENSP00000263196	0.775	Integral membrane protein DGCR2/IDD
15	9606.ENSP00000349430	0.768	Histone H2B type 1-K
16	9606.ENSP00000289316	0.755	Histone H2B type 1-D
17	9606.ENSP00000262144	0.753	GATOR complex protein WDR59
18	9606.ENSP00000255120	0.746	Nuclear autoantigenic sperm protein
19	9606.ENSP00000244537	0.744	Histone cluster 1 H4 family member f
20	9606.ENSP00000366953	0.743	DDB1- and CUL4-associated factor 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140110	0.556	transcription regulator activity
GO:0003712	0.507	transcription coregulator activity
GO:0003682	0.315	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.982	cellular component organization
GO:0006325	0.952	chromatin organization
GO:0006338	0.923	chromatin remodeling
GO:0043933	0.918	protein-containing complex organization
GO:0050794	0.895	regulation of cellular process
GO:0032502	0.842	developmental process
GO:0048856	0.833	anatomical structure development
GO:0071824	0.820	protein-DNA complex subunit organization
GO:0022607	0.805	cellular component assembly
GO:0019222	0.760	regulation of metabolic process
GO:0034728	0.702	nucleosome organization
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0065003	0.635	protein-containing complex assembly
GO:0080090	0.610	regulation of primary metabolic process
GO:0031323	0.604	regulation of cellular metabolic process
GO:0051171	0.602	regulation of nitrogen compound metabolic process
GO:0009889	0.592	regulation of biosynthetic process
GO:0019219	0.561	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.559	regulation of macromolecule biosynthetic process
GO:0010468	0.557	regulation of gene expression
GO:0031326	0.556	regulation of cellular biosynthetic process
GO:0051252	0.547	regulation of RNA metabolic process
GO:2001141	0.538	regulation of RNA biosynthetic process
GO:0006355	0.531	regulation of DNA-templated transcription
GO:0065004	0.528	protein-DNA complex assembly
GO:0006334	0.519	nucleosome assembly
GO:0009653	0.494	anatomical structure morphogenesis
GO:0032501	0.423	multicellular organismal process
GO:0006357	0.356	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0000785	0.996	chromatin
GO:0032991	0.989	protein-containing complex
GO:0005576	0.883	extracellular region
GO:0005615	0.778	extracellular space
GO:0005737	0.522	cytoplasm
GO:0031982	0.484	vesicle
GO:0043230	0.446	extracellular organelle
GO:0065010	0.426	extracellular membrane-bounded organelle
GO:0005829	0.396	cytosol
GO:1903561	0.324	extracellular vesicle
GO:0070062	0.313	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]