StarFunc result for job id P54252

User Input

>input (361 residues)
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRT
FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW
FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM
IRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEI
DMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQ
QQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLETVRNDLKTEGK
K

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F5H211	0.573	0.559	1.076E-60	370	1.000	0.976	F5H211.pdb.gz	F5H211_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=2
2	AFDB:O35815	0.655	0.665	7.115E-56	355	0.853	0.868	O35815.pdb.gz	ATX3_RAT Ataxin-3 OS=Rattus norvegicus OX=10116 GN=Atxn3 PE=1 SV=1
3	AFDB:Q9H3M9	0.508	0.517	3.826E-41	355	0.684	0.696	Q9H3M9.pdb.gz	ATX3L_HUMAN Ataxin-3-like protein OS=Homo sapiens OX=9606 GN=ATXN3L PE=1 SV=2
4	AFDB:A0A0A0MS38	0.344	0.395	2.737E-38	310	0.859	1.000	A0A0A0MS38.pdb.gz	A0A0A0MS38_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
5	AFDB:O17850	0.477	0.540	7.440E-24	317	0.294	0.334	O17850.pdb.gz	ATX3_CAEEL Ataxin-3 homolog OS=Caenorhabditis elegans OX=6239 GN=atx-3 PE=1 SV=1
6	AFDB:Q9M391	0.454	0.582	8.814E-22	280	0.258	0.332	Q9M391.pdb.gz	ATX3H_ARATH Ataxin-3 homolog OS=Arabidopsis thaliana OX=3702 GN=At3g54130 PE=1 SV=1
7	PDB:6pgvA	0.303	0.692	3.809E-8	152	0.114	0.270	6pgvA.pdb.gz	Structural insights into the activity and regulation of human Josephin-2
8	PDB:7oiyA	0.269	0.371	2.207E-2	244	0.050	0.074	7oiyA.pdb.gz
9	PDB:4uelA	0.194	0.229	8.633E-2	302	0.066	0.079	4uelA.pdb.gz
10	PDB:2fn0B	0.071	0.063	1.177E-1	412	0.033	0.029	2fn0B.pdb.gz	Crystal Structures of Yersinia enterocolitica Salicylate Synthase and its Complex with the Reaction Products Salicylate and Pyruvate.
11	PDB:5cvnB	0.132	0.146	1.708E-1	321	0.025	0.028	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
12	PDB:1uchA	0.164	0.270	2.057E-1	206	0.061	0.107	1uchA.pdb.gz
13	PDB:2we6A	0.170	0.275	2.477E-1	208	0.044	0.077	2we6A.pdb.gz
14	PDB:3mhsA	0.089	0.073	2.804E-1	455	0.036	0.029	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
15	PDB:2lenA	0.143	0.204	3.594E-1	231	0.061	0.095	2lenA.pdb.gz
16	PDB:5xdaB	0.234	0.167	3.824E-1	542	0.061	0.041	5xdaB.pdb.gz
17	AFDB:Q38AR0	0.085	0.109	7.879E-1	268	0.100	0.134	Q38AR0.pdb.gz	Q38AR0_TRYB2 RRM domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3710 PE=4 SV=1
18	AFDB:Q557J6	0.089	0.073	1.074	481	0.136	0.102	Q557J6.pdb.gz	DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum OX=44689 GN=abpE-1 PE=2 SV=1
19	AFDB:F4JUD2	0.106	0.044	1.216	969	0.094	0.035	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
20	AFDB:Q95PZ0	0.087	0.077	1.377	426	0.119	0.101	Q95PZ0.pdb.gz	CSN6_CAEEL COP9 signalosome complex subunit 6 OS=Caenorhabditis elegans OX=6239 GN=csn-6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS38	0.0	605	310	0.859	1.000	A0A0A0MS38_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
2	C9JQV6	0.0	580	291	0.787	0.976	C9JQV6_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=3
3	D3VVH9	0.0	601	301	0.803	0.963	D3VVH9_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
4	F5H211	0.0	734	370	1.000	0.976	F5H211_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=2
5	G3V328	0.0	518	260	0.701	0.973	G3V328_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
6	G3V3R7	0.0	673	329	0.911	1.000	G3V3R7_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
7	G3V4U9	0.0	542	278	0.770	1.000	G3V4U9_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
8	O35815	0.0	626	355	0.853	0.868	ATX3_RAT Ataxin-3 OS=Rattus norvegicus OX=10116 GN=Atxn3 PE=1 SV=1
9	P54252	0.0	741	361	1.000	1.000	ATX3_HUMAN Ataxin-3 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=5
10	Q4VBR4	0.0	735	370	1.000	0.976	Q4VBR4_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
11	Q9CVD2	0.0	610	355	0.853	0.868	ATX3_MOUSE Ataxin-3 OS=Mus musculus OX=10090 GN=Atxn3 PE=1 SV=2
12	Q9H3M9	2.60e-169	478	355	0.693	0.704	ATX3L_HUMAN Ataxin-3-like protein OS=Homo sapiens OX=9606 GN=ATXN3L PE=1 SV=2
13	G3V2G1	5.88e-145	410	223	0.596	0.964	G3V2G1_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=1
14	G3V2G2	9.84e-102	298	150	0.416	1.000	G3V2G2_HUMAN Ataxin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=2
15	G3V3T6	1.04e-81	246	126	0.349	1.000	G3V3T6_HUMAN Ataxin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=2
16	O17850	5.60e-53	179	317	0.307	0.350	ATX3_CAEEL Ataxin-3 homolog OS=Caenorhabditis elegans OX=6239 GN=atx-3 PE=1 SV=1
17	Q9M391	1.44e-46	161	280	0.260	0.336	ATX3H_ARATH Ataxin-3 homolog OS=Arabidopsis thaliana OX=3702 GN=At3g54130 PE=1 SV=1
18	Q803C0	1.75e-09	58.9	184	0.144	0.283	Q803C0_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:55937 PE=1 SV=1
19	Q8TAC2	6.33e-08	54.3	188	0.119	0.229	JOS2_HUMAN Josephin-2 OS=Homo sapiens OX=9606 GN=JOSD2 PE=1 SV=1
20	Q08C38	1.11e-07	54.3	235	0.125	0.191	Q08C38_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:153682 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12446 DUF3682	4.4e+02	12.8	Protein of unknown function (DUF3682)
2	PF02099 Josephin	3.2e-51	185.1	Josephin
3	PF16619 SUIM_assoc	2.6e-28	109.0	Unstructured region C-term to UIM in Ataxin3
4	PF02809 UIM	2.4e-09	47.4	Ubiquitin interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.999	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000441543	0.999	Polyubiquitin-C
3	9606.ENSP00000467024	0.998	UV excision repair protein RAD23 homolog A
4	9606.ENSP00000355865	0.995	E3 ubiquitin-protein ligase parkin
5	9606.ENSP00000355231	0.994	Beclin-1
6	9606.ENSP00000272317	0.993	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000219548	0.990	E3 ubiquitin-protein ligase CHIP
8	9606.ENSP00000306253	0.988	Inositol 1,4,5-trisphosphate receptor type 1
9	9606.ENSP00000304697	0.986	Polyubiquitin-B
10	9606.ENSP00000350708	0.984	UV excision repair protein RAD23 homolog B
11	9606.ENSP00000388107	0.979	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000366843	0.972	Ataxin-2
13	9606.ENSP00000302967	0.960	Histone deacetylase 3
14	9606.ENSP00000334061	0.959	Histone deacetylase 6
15	9606.ENSP00000363377	0.956	Forkhead box protein O4
16	9606.ENSP00000328551	0.938	Ras-related protein Rab-28
17	9606.ENSP00000347184	0.917	Huntingtin
18	9606.ENSP00000446252	0.908	Superoxide dismutase [Mn], mitochondrial
19	9606.ENSP00000343001	0.892	Ubiquitin conjugation factor E4 B
20	9606.ENSP00000378917	0.873	Ataxin-2-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.999	ubiquitin protein ligase binding
GO:0004843	0.998	cysteine-type deubiquitinase activity
GO:0097159	0.791	organic cyclic compound binding
GO:1901363	0.775	heterocyclic compound binding
GO:1990380	0.732	K48-linked deubiquitinase activity
GO:0003676	0.673	nucleic acid binding
GO:0061578	0.605	K63-linked deubiquitinase activity
GO:0051117	0.579	ATPase binding
GO:0042802	0.495	identical protein binding
GO:0008134	0.471	transcription factor binding
GO:0003677	0.443	DNA binding
GO:0019213	0.407	deacetylase activity
GO:0033558	0.401	protein lysine deacetylase activity
GO:0001221	0.398	transcription coregulator binding
GO:0004407	0.390	histone deacetylase activity
GO:0043565	0.377	sequence-specific DNA binding
GO:0003690	0.377	double-stranded DNA binding
GO:1990837	0.368	sequence-specific double-stranded DNA binding
GO:0001067	0.335	transcription regulatory region nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0036211	0.994	protein modification process
GO:0065007	0.987	biological regulation
GO:0009987	0.986	cellular process
GO:0050789	0.978	regulation of biological process
GO:0006508	0.978	proteolysis
GO:0070647	0.976	protein modification by small protein conjugation or removal
GO:0050896	0.975	response to stimulus
GO:0050794	0.972	regulation of cellular process
GO:0044237	0.967	cellular metabolic process
GO:0070646	0.964	protein modification by small protein removal
GO:0051716	0.925	cellular response to stimulus
GO:0033554	0.868	cellular response to stress
GO:0019222	0.828	regulation of metabolic process
GO:0060255	0.775	regulation of macromolecule metabolic process
GO:0080090	0.737	regulation of primary metabolic process
GO:0051171	0.737	regulation of nitrogen compound metabolic process
GO:0016579	0.695	protein deubiquitination
GO:0044260	0.649	cellular macromolecule metabolic process
GO:0009056	0.567	catabolic process
GO:0030163	0.560	protein catabolic process
GO:0048518	0.537	positive regulation of biological process
GO:0051603	0.533	proteolysis involved in protein catabolic process
GO:0071840	0.512	cellular component organization or biogenesis
GO:0042221	0.501	response to chemical
GO:0048522	0.484	positive regulation of cellular process
GO:0009893	0.475	positive regulation of metabolic process
GO:0048583	0.468	regulation of response to stimulus
GO:0010604	0.465	positive regulation of macromolecule metabolic process
GO:0031323	0.453	regulation of cellular metabolic process
GO:0051246	0.450	regulation of protein metabolic process
GO:0010498	0.444	proteasomal protein catabolic process
GO:0051173	0.441	positive regulation of nitrogen compound metabolic process
GO:0016043	0.439	cellular component organization
GO:0010033	0.431	response to organic substance
GO:0032501	0.384	multicellular organismal process
GO:0009894	0.343	regulation of catabolic process
GO:0048519	0.314	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0071944	0.997	cell periphery
GO:0005886	0.993	plasma membrane
GO:0005730	0.961	nucleolus
GO:0005829	0.944	cytosol
GO:0012505	0.507	endomembrane system
GO:0031090	0.440	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.998	ubiquitinyl hydrolase 1.
RHEA:58108	0.401	H2O + N(6)-acetyl-L-lysyl-[protein] = acetate + L-lysyl-[protein]
RHEA:58196	0.390	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.390	histone deacetylase.

[back to server]