StarFunc result for job id P54253

User Input

>input (815 residues)
MKSNQERSNECLPPKKREIPATSRSSEEKAPTLPSDNHRVEGTAWLPGNPGGRGHGGGRH
GPAGTSVELGLQQGIGLHKALSTGLDYSPPSAPRSVPVATTLPAAYATPQPGTPVSPVQY
AHLPHTFQFIGSSQYSGTYASFIPSQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTL
LANMGSLSQTPGHKAEQQQQQQQQQQQQHQHQQQQQQQQQQQQQQHLSRAPGLITPGSPP
PAQQNQYVHISSSPQNTGRTASPPAIPVHLHPHQTMIPHTLTLGPPSQVVMQYADSGSHF
VPREATKKAESSRLQQAIQAKEVLNGEMEKSRRYGAPSSADLGLGKAGGKSVPHPYESRH
VVVHPSPSDYSSRDPSGVRASVMVLPNSNTPAADLEVQQATHREASPSTLNDKSGLHLGK
PGHRSYALSPHTVIQTTHSASEPLPVGLPATAFYAGTQPPVIGYLSGQQQAITYAGSLPQ
HLVIPGTQPLLIPVGSTDMEASGAAPAIVTSSPQFAAVPHTFVTTALPKSENFNPEALVT
QAAYPAMVQAQIHLPVVQSVASPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQ
SAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSC
CPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQPVDPASVLLKHSKADGLAGSR
HRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATRKRRWSAPESR
KLEKSEDEPPLTLPKPSLIPQEVKICIEGRSNVGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54253	1.000	1.000	0.000	815	1.000	1.000	P54253.pdb.gz	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
2	AFDB:P54254	0.279	0.285	2.407E-89	791	0.867	0.894	P54254.pdb.gz	ATX1_MOUSE Ataxin-1 OS=Mus musculus OX=10090 GN=Atxn1 PE=1 SV=2
3	AFDB:E7F6Z5	0.211	0.208	7.179E-37	827	0.347	0.342	E7F6Z5.pdb.gz	E7F6Z5_DANRE Ataxin 1b OS=Danio rerio OX=7955 GN=atxn1b PE=3 SV=1
4	AFDB:Q9N415	0.052	0.037	1.230E-2	1276	0.147	0.094	Q9N415.pdb.gz	Q9N415_CAEEL Variant SH3 domain protein OS=Caenorhabditis elegans OX=6239 GN=rimb-1 PE=1 SV=3
5	AFDB:P0C1X8	0.051	0.045	2.385E-2	962	0.141	0.120	P0C1X8.pdb.gz	AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1
6	AFDB:Q9VVJ8	0.048	0.047	3.222E-2	797	0.160	0.163	Q9VVJ8.pdb.gz	Q9VVJ8_DROME CREB-regulated transcription coactivator, isoform A OS=Drosophila melanogaster OX=7227 GN=Crtc PE=1 SV=1
7	AFDB:E9Q9R9	0.054	0.027	3.422E-2	1921	0.135	0.057	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
8	AFDB:Q90X22	0.052	0.039	3.860E-2	1276	0.145	0.092	Q90X22.pdb.gz
9	AFDB:Q0KIB0	0.051	0.032	4.099E-2	1689	0.146	0.070	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
10	AFDB:F1SPM8	0.062	0.054	7.045E-2	968	0.141	0.119	F1SPM8.pdb.gz	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
11	PDB:7a1gh	0.040	0.396	1.139E-1	63	0.007	0.095	7a1gh.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
12	PDB:1b9mA	0.057	0.160	1.285E-1	258	0.015	0.047	1b9mA.pdb.gz
13	PDB:3j79D	0.045	0.112	2.079E-1	247	0.018	0.061	3j79D.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
14	PDB:3cqzH	0.060	0.332	2.208E-1	116	0.016	0.112	3cqzH.pdb.gz	The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
15	PDB:7krjC	0.046	0.185	2.491E-1	133	0.015	0.090	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
16	PDB:4v6wAc	0.054	0.522	3.573E-1	62	0.007	0.097	4v6wAc.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:7r7jB	0.057	0.078	4.030E-1	574	0.012	0.017	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
18	PDB:2kmwA	0.043	0.161	5.445E-1	150	0.020	0.107	2kmwA.pdb.gz
19	PDB:2waqG	0.044	0.270	5.783E-1	113	0.007	0.053	2waqG.pdb.gz	Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
20	PDB:6wxuB	0.038	0.068	6.142E-1	273	0.011	0.033	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54253	0.0	1647	815	1.000	1.000	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
2	P54254	0.0	1383	791	0.870	0.896	ATX1_MOUSE Ataxin-1 OS=Mus musculus OX=10090 GN=Atxn1 PE=1 SV=2
3	Q1L966	8.11e-173	520	781	0.476	0.497	Q1L966_DANRE Ataxin 1a OS=Danio rerio OX=7955 GN=atxn1b PE=2 SV=1
4	E7F6Z5	2.94e-125	397	827	0.404	0.398	E7F6Z5_DANRE Ataxin 1b OS=Danio rerio OX=7955 GN=atxn1b PE=3 SV=1
5	P0C7T5	1.44e-57	211	689	0.135	0.160	ATX1L_HUMAN Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE=1 SV=1
6	P0C7T6	3.80e-56	207	687	0.135	0.160	ATX1L_MOUSE Ataxin-1-like OS=Mus musculus OX=10090 GN=Atxn1l PE=1 SV=1
7	E7FB74	1.98e-47	183	765	0.200	0.213	E7FB74_DANRE Ataxin-1-like OS=Danio rerio OX=7955 GN=atxn1l PE=3 SV=2
8	Q9W3V7	6.62e-28	114	230	0.061	0.217	Q9W3V7_DROME Ataxin 1 OS=Drosophila melanogaster OX=7227 GN=Atx-1 PE=2 SV=1
9	Q8R316	1.07e-06	54.7	516	0.044	0.070	HBP1_MOUSE HMG box-containing protein 1 OS=Mus musculus OX=10090 GN=Hbp1 PE=1 SV=1
10	O60381	1.27e-06	54.3	514	0.045	0.072	HBP1_HUMAN HMG box-containing protein 1 OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=2
11	H7C4S2	1.32e-06	53.9	454	0.045	0.081	H7C4S2_HUMAN HMG-box transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=1
12	Q62661	3.28e-05	49.7	513	0.045	0.072	HBP1_RAT HMG box-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Hbp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12547 ATXN-1_C	2.4e-194	659.1	Ataxin-1 like family
2	PF08517 AXH	5.3e-37	138.1	Ataxin-1 and HBP1 module (AXH)
3	PF11526 CFIA_Pcf11	3.3e+02	13.2	Subunit of cleavage factor IA Pcf11
4	PF12922 Cnd1_N	3.9e+02	12.3	non-SMC mitotic condensation complex subunit 1, N-term
5	PF02862 DDHD	2e+02	13.4	DDHD domain
6	PF15549 PGC7_Stella	44	15.7	PGC7/Stella/Dppa3 domain
7	PF01080 Presenilin	9e+02	10.0	Presenilin
8	PF15101 TERB2	1.1e+02	14.1	Telomere-associated protein TERB2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388638	0.994	Splicing factor 45
2	9606.ENSP00000458663	0.994	Protein capicua homolog
3	9606.ENSP00000340330	0.992	Histone acetyltransferase KAT5
4	9606.ENSP00000345206	0.975	Recombining binding protein suppressor of hairless
5	9606.ENSP00000417864	0.966	Acidic leucine-rich nuclear phosphoprotein 32 family member A
6	9606.ENSP00000357292	0.950	Ubiquilin-4
7	9606.ENSP00000218224	0.939	Polyglutamine-binding protein 1
8	9606.ENSP00000415822	0.905	Ataxin-1-like
9	9606.ENSP00000347184	0.903	Huntingtin
10	9606.ENSP00000379287	0.898	14-3-3 protein zeta/delta
11	9606.ENSP00000366843	0.869	Ataxin-2
12	9606.ENSP00000478320	0.850	Ataxin-3
13	9606.ENSP00000240316	0.847	Coilin
14	9606.ENSP00000219548	0.844	E3 ubiquitin-protein ligase CHIP
15	9606.ENSP00000439585	0.827	Ataxin-7
16	9606.ENSP00000338173	0.825	Pumilio homolog 2
17	9606.ENSP00000359357	0.820	Zinc finger protein Gfi-1
18	9606.ENSP00000413035	0.820	RNA binding protein fox-1 homolog 2
19	9606.ENSP00000264335	0.814	14-3-3 protein epsilon
20	9606.ENSP00000307863	0.808	Splicing factor U2AF 65 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0042802	0.990	identical protein binding
GO:0008266	0.987	poly(U) RNA binding
GO:0043621	0.985	protein self-association
GO:0070717	0.985	poly-purine tract binding
GO:0034046	0.944	poly(G) binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0019222	0.978	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0080090	0.963	regulation of primary metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0048519	0.953	negative regulation of biological process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0048523	0.939	negative regulation of cellular process
GO:0010468	0.913	regulation of gene expression
GO:0010605	0.909	negative regulation of macromolecule metabolic process
GO:0051172	0.908	negative regulation of nitrogen compound metabolic process
GO:0031324	0.908	negative regulation of cellular metabolic process
GO:0031326	0.906	regulation of cellular biosynthetic process
GO:0010556	0.898	regulation of macromolecule biosynthetic process
GO:0006355	0.890	regulation of DNA-templated transcription
GO:0045934	0.881	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.872	negative regulation of RNA metabolic process
GO:0009890	0.860	negative regulation of biosynthetic process
GO:0010558	0.850	negative regulation of macromolecule biosynthetic process
GO:0031327	0.848	negative regulation of cellular biosynthetic process
GO:0008152	0.832	metabolic process
GO:0071704	0.821	organic substance metabolic process
GO:0044238	0.814	primary metabolic process
GO:0051179	0.810	localization
GO:0045892	0.785	negative regulation of DNA-templated transcription
GO:0006807	0.771	nitrogen compound metabolic process
GO:0048518	0.706	positive regulation of biological process
GO:0043170	0.667	macromolecule metabolic process
GO:0044237	0.591	cellular metabolic process
GO:0051234	0.517	establishment of localization
GO:0051641	0.514	cellular localization
GO:0050896	0.505	response to stimulus
GO:0048522	0.464	positive regulation of cellular process
GO:0006357	0.424	regulation of transcription by RNA polymerase II
GO:0006810	0.417	transport
GO:0009893	0.408	positive regulation of metabolic process
GO:0051716	0.382	cellular response to stimulus
GO:0010604	0.374	positive regulation of macromolecule metabolic process
GO:0031325	0.361	positive regulation of cellular metabolic process
GO:0051649	0.357	establishment of localization in cell
GO:0051173	0.343	positive regulation of nitrogen compound metabolic process
GO:0046907	0.320	intracellular transport
GO:0032501	0.305	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.990	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005829	0.971	cytosol
GO:0016234	0.938	inclusion body
GO:0042405	0.902	nuclear inclusion body
GO:0032991	0.854	protein-containing complex
GO:0005730	0.732	nucleolus
GO:0034399	0.489	nuclear periphery
GO:0016363	0.428	nuclear matrix
GO:0012505	0.393	endomembrane system
GO:0016020	0.305	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]