StarFunc result for job id P54259

User Input

>input (1190 residues)
MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVE
EASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDGRSLNDDGSSD
PRDIDQDNRSTSPSIYSPGSVENDSDSSSGLSQGPARPYHPPPLFPPSPQPPDSTPRQPE
ASFEPHPSVTPTGYHAPMEPPTSRMFQAPPGAPPPHPQLYPGGTGGVLSGPPMGPKGGGA
ASSVGGPNGGKQHPPPTTPISVSSSGASGAPPTKPPTTPVGGGNLPSAPPPANFPHVTPN
LPPPPALRPLNNASASPPGLGAQPLPGHLPSPHAMGQGMGGLPPGPEKGPTLAPSPHSLP
PASSSAPAPPMRFPYSSSSSSSAAASSSSSSSSSSASPFPASQALPSYPHSFPPPTSLSV
SNQPPKYTQPSLPSQAVWSQGPPPPPPYGRLLANSNAHPGPFPPSTGAQSTAHPPVSTHH
HHHQQQQQQQQQQQQQQQQQQQHHGNSGPPPPGAFPHPLEGGSSHHAHPYAMSPSLGSLR
PYPPGPAHLPPPHSQVSYSQAGPNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGAPYP
FPPVPTVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPG
SPPSFRTGTPPGYRGTSPPAGPGTFKPGSPTVGPGPLPPAGPSGLPSLPPPPAAPASGPP
LSATQIKQEPAEEYETPESPVPPARSPSPPPKVVDVPSHASQSARFNKHLDRGFNSCARS
DLYFVPLEGSKLAKKRADLVEKVRREAEQRAREEKEREREREREKEREREKERELERSVK
LAQEGRAPVECPSLGPVPHRPPFEPGSAVATVPPYLGPDTPALRTLSEYARPHVMSPGNR
NHPFYVPLGAVDPGLLGYNVPALYSSDPAAREREREARERDLRDRLKPGFEVKPSELEPL
HGVPGPGLDPFPRHGGLALQPGPPGLHPFPFHPSLGPLERERLALAAGPALRPDMSYAER
LAAERQHAERVAALGNDPLARLQMLNVTPHHHQHSHIHSHLHLHQQDAIHAASASVHPLI
DPLASGSHLTRIPYPAGTLPNPLLPHPLHENEVLRHQLFAAPYRDLPASLSAPMSAAHQL
QAMHAQSAELQRLALEQQQWLHAHHPLHSVPLPAQEDYYSHLKKESDKPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86V38	0.151	0.151	0.000	1191	1.000	0.999	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
2	AFDB:P29617	0.034	0.026	4.017E-5	1703	0.165	0.115	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
3	AFDB:F1R3C6	0.035	0.023	1.821E-4	1855	0.142	0.091	F1R3C6.pdb.gz	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
4	AFDB:Q8BZ47	0.039	0.036	2.076E-4	1413	0.195	0.164	Q8BZ47.pdb.gz	ZN609_MOUSE Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2
5	AFDB:Q56A10	0.042	0.034	2.217E-4	1511	0.166	0.130	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
6	AFDB:P51521	0.044	0.039	2.529E-4	1351	0.142	0.125	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
7	AFDB:Q8IRB5	0.037	0.031	2.884E-4	1465	0.133	0.108	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
8	AFDB:M9PHT1	0.088	0.058	3.512E-4	2007	0.234	0.139	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
9	AFDB:Q8IHQ2	0.040	0.038	8.813E-4	1301	0.081	0.074	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
10	AFDB:Q9NJB5	0.035	0.038	8.813E-4	1081	0.141	0.155	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
11	PDB:7o4iW	0.026	0.079	3.710	312	0.018	0.067	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
12	PDB:7cunI	0.021	0.036	4.518	624	0.004	0.008	7cunI.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
13	PDB:7ungi	0.023	0.088	5.502	250	0.021	0.100	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:2w1vA	0.023	0.073	6.275	274	0.004	0.018	2w1vA.pdb.gz
15	PDB:4v6iBU	0.032	0.172	7.156	160	0.008	0.062	4v6iBU.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
16	PDB:3n5bB	0.025	0.213	9.307	86	0.004	0.058	3n5bB.pdb.gz	Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
17	PDB:6uenE	0.017	0.135	9.307	114	0.006	0.061	6uenE.pdb.gz
18	PDB:7mqaSQ	0.021	0.119	9.307	156	0.021	0.160	7mqaSQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7qi4e	0.030	0.104	9.307	238	0.011	0.055	7qi4e.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
20	PDB:6j6qF	0.031	0.181	9.940	161	0.014	0.106	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35126	0.0	1490	1175	0.916	0.928	ATN1_MOUSE Atrophin-1 OS=Mus musculus OX=10090 GN=Atn1 PE=1 SV=1
2	P54258	0.0	1605	1183	0.923	0.928	ATN1_RAT Atrophin-1 OS=Rattus norvegicus OX=10116 GN=Atn1 PE=1 SV=1
3	P54259	0.0	2298	1190	1.000	1.000	ATN1_HUMAN Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3
4	Q86V38	0.0	2294	1191	1.000	0.999	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
5	Q80TZ9	7.21e-130	436	1558	0.276	0.211	RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus OX=10090 GN=Rere PE=1 SV=3
6	Q9P2R6	1.91e-128	432	1566	0.272	0.207	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
7	Q8MQW5	1.04e-16	88.6	1153	0.057	0.059	Q8MQW5_DROME SD07343p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1
8	M9PHT1	6.22e-16	86.3	2007	0.074	0.044	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
9	Q7KUA8	6.63e-16	85.9	1985	0.074	0.044	Q7KUA8_DROME Grunge, isoform D OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
10	Q9VSK5	6.80e-16	85.9	1985	0.057	0.034	Q9VSK5_DROME Grunge, isoform H OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=2
11	Q86BH2	7.04e-16	85.9	1988	0.074	0.044	Q86BH2_DROME Grunge, isoform C OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
12	Q8T9N4	7.86e-16	85.9	1985	0.057	0.034	Q8T9N4_DROME Transcriptional corepressor Atro OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1
13	M9NE54	2.94e-15	84.0	2006	0.056	0.033	M9NE54_DROME Grunge, isoform G OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
14	M9NDL9	1.70e-14	81.3	1988	0.053	0.032	M9NDL9_DROME Grunge, isoform F OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
15	Q8IQA6	1.85e-14	81.3	1966	0.053	0.032	Q8IQA6_DROME Grunge, isoform A OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
16	M9PES2	1.88e-14	81.3	1983	0.053	0.032	M9PES2_DROME Grunge, isoform I OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
17	Q9NHX6	2.01e-14	81.3	1966	0.053	0.032	Q9NHX6_DROME GRUNGE OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1
18	Q8SX83	0.017	42.0	5560	0.016	0.003	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03154 Atrophin-1	1.3e-217	737.2	Atrophin-1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349076

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357979	0.950	Nuclear receptor subfamily 2 group E member 1
2	9606.ENSP00000316338	0.895	Brain-specific angiogenesis inhibitor 1-associated protein 2
3	9606.ENSP00000307746	0.814	Zinc finger protein 608
4	9606.ENSP00000427793	0.806	NEDD4-like E3 ubiquitin-protein ligase WWP1
5	9606.ENSP00000478320	0.802	Ataxin-3
6	9606.ENSP00000244769	0.766	Ataxin-1
7	9606.ENSP00000439585	0.760	Ataxin-7
8	9606.ENSP00000440674	0.758	Polyhomeotic-like protein 1
9	9606.ENSP00000333633	0.749	Metastasis-associated protein MTA1
10	9606.ENSP00000340176	0.745	RNA-binding protein with multiple splicing
11	9606.ENSP00000278823	0.737	Metastasis-associated protein MTA2
12	9606.ENSP00000366843	0.732	Ataxin-2
13	9606.ENSP00000385450	0.732	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
14	9606.ENSP00000383973	0.728	Metastasis-associated protein MTA3
15	9606.ENSP00000217086	0.723	Sal-like protein 4
16	9606.ENSP00000355094	0.723	Protein quaking
17	9606.ENSP00000357644	0.709	Transcriptional repressor p66-beta
18	9606.ENSP00000269305	0.705	Cellular tumor antigen p53
19	9606.ENSP00000257118	0.701	Polyhomeotic-like protein 2
20	9606.ENSP00000369716	0.701	Chromodomain-helicase-DNA-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.734	transcription regulator activity
GO:0003712	0.540	transcription coregulator activity
GO:0003714	0.426	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0019222	0.969	regulation of metabolic process
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0080090	0.902	regulation of primary metabolic process
GO:0051171	0.901	regulation of nitrogen compound metabolic process
GO:0031323	0.895	regulation of cellular metabolic process
GO:0048523	0.877	negative regulation of cellular process
GO:0010468	0.804	regulation of gene expression
GO:0019219	0.718	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.716	regulation of macromolecule biosynthetic process
GO:0051252	0.714	regulation of RNA metabolic process
GO:2001141	0.697	regulation of RNA biosynthetic process
GO:0010605	0.664	negative regulation of macromolecule metabolic process
GO:0006355	0.662	regulation of DNA-templated transcription
GO:0051172	0.650	negative regulation of nitrogen compound metabolic process
GO:0031324	0.650	negative regulation of cellular metabolic process
GO:0045934	0.624	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.593	negative regulation of macromolecule biosynthetic process
GO:0031327	0.590	negative regulation of cellular biosynthetic process
GO:0051253	0.558	negative regulation of RNA metabolic process
GO:0032501	0.557	multicellular organismal process
GO:0045892	0.543	negative regulation of DNA-templated transcription
GO:0000122	0.531	negative regulation of transcription by RNA polymerase II
GO:0032502	0.490	developmental process
GO:0048856	0.472	anatomical structure development
GO:0007275	0.414	multicellular organism development
GO:0048731	0.353	system development
GO:0048518	0.326	positive regulation of biological process
GO:0008152	0.307	metabolic process
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0032991	0.390	protein-containing complex
GO:0043232	0.388	intracellular non-membrane-bounded organelle
GO:0005829	0.379	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]