StarFunc result for job id P54274

User Input

>input (439 residues)
MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEE
EEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQL
RTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQA
IAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKI
KSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDK
QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATES
RIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML
KDRWRTMKKLKLISSDSED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54274	1.000	1.000	4.936E-54	439	1.000	1.000	P54274.pdb.gz	TERF1_HUMAN Telomeric repeat-binding factor 1 OS=Homo sapiens OX=9606 GN=TERF1 PE=1 SV=3
2	AFDB:Q5EB98	0.570	0.593	2.566E-35	421	0.651	0.679	Q5EB98.pdb.gz
3	AFDB:P70371	0.571	0.594	3.027E-34	421	0.642	0.670	P70371.pdb.gz	TERF1_MOUSE Telomeric repeat-binding factor 1 OS=Mus musculus OX=10090 GN=Terf1 PE=1 SV=1
4	AFDB:Q7T1R9	0.454	0.573	2.713E-20	345	0.330	0.420	Q7T1R9.pdb.gz	Q7T1R9_CHICK TTAGGG repeat binding factor 1 (Fragment) OS=Gallus gallus OX=9031 GN=TERF1 PE=2 SV=1
5	AFDB:A7MD83	0.462	0.548	1.487E-17	365	0.251	0.301	A7MD83.pdb.gz
6	AFDB:Q15554	0.453	0.372	1.143E-15	542	0.267	0.216	Q15554.pdb.gz	TERF2_HUMAN Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3
7	AFDB:O35144	0.476	0.394	3.582E-15	541	0.278	0.226	O35144.pdb.gz	TERF2_MOUSE Telomeric repeat-binding factor 2 OS=Mus musculus OX=10090 GN=Terf2 PE=1 SV=3
8	AFDB:B1H237	0.467	0.442	6.935E-11	466	0.200	0.189	B1H237.pdb.gz	B1H237_RAT Terf2 protein OS=Rattus norvegicus OX=10116 GN=Terf2 PE=2 SV=1
9	AFDB:Q9PU53	0.439	0.278	5.328E-9	718	0.173	0.106	Q9PU53.pdb.gz	TERF2_CHICK Telomeric repeat-binding factor 2 OS=Gallus gallus OX=9031 GN=TERF2 PE=1 SV=2
10	AFDB:Q8C0V1	0.113	0.075	1.888E-2	768	0.107	0.061	Q8C0V1.pdb.gz	TERB1_MOUSE Telomere repeats-binding bouquet formation protein 1 OS=Mus musculus OX=10090 GN=Terb1 PE=1 SV=2
11	PDB:3zc0B	0.183	0.362	9.867E-2	191	0.066	0.152	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
12	PDB:6swy8	0.195	0.245	2.461E-1	325	0.077	0.105	6swy8.pdb.gz
13	PDB:4abnB	0.133	0.136	5.113E-1	426	0.052	0.054	4abnB.pdb.gz
14	PDB:5kucA	0.110	0.117	5.113E-1	402	0.055	0.060	5kucA.pdb.gz
15	PDB:4q25A	0.097	0.174	6.726E-1	211	0.062	0.128	4q25A.pdb.gz
16	PDB:2ff4A	0.159	0.178	1.015	379	0.050	0.058	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
17	PDB:2noxB	0.109	0.152	1.015	266	0.071	0.117	2noxB.pdb.gz	Crystal structure and mechanism of tryptophan 2,3-dioxygenase, a heme enzyme involved in tryptophan catabolism and in quinolinate biosynthesis.
18	PDB:7pntV	0.171	0.196	1.062	365	0.057	0.068	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
19	PDB:1qoyA	0.100	0.134	1.164	303	0.052	0.076	1qoyA.pdb.gz
20	PDB:7wnqA	0.103	0.117	1.164	368	0.071	0.084	7wnqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54274	0.0	914	439	1.000	1.000	TERF1_HUMAN Telomeric repeat-binding factor 1 OS=Homo sapiens OX=9606 GN=TERF1 PE=1 SV=3
2	P70371	0.0	548	421	0.645	0.672	TERF1_MOUSE Telomeric repeat-binding factor 1 OS=Mus musculus OX=10090 GN=Terf1 PE=1 SV=1
3	A0A8I5Y1U3	9.58e-163	466	392	0.601	0.673	A0A8I5Y1U3_RAT Telomeric repeat-binding factor OS=Rattus norvegicus OX=10116 GN=Terf1 PE=4 SV=1
4	Q7T1R9	2.21e-87	271	345	0.362	0.461	Q7T1R9_CHICK TTAGGG repeat binding factor 1 (Fragment) OS=Gallus gallus OX=9031 GN=TERF1 PE=2 SV=1
5	D3ZJF7	2.81e-33	133	536	0.276	0.226	D3ZJF7_RAT Telomeric repeat-binding factor OS=Rattus norvegicus OX=10116 GN=Terf2 PE=1 SV=3
6	O35144	3.38e-20	95.1	541	0.146	0.118	TERF2_MOUSE Telomeric repeat-binding factor 2 OS=Mus musculus OX=10090 GN=Terf2 PE=1 SV=3
7	F6KWE7	6.24e-20	92.4	320	0.137	0.188	F6KWE7_RAT Telomeric repeat binding factor 2 isoform OS=Rattus norvegicus OX=10116 GN=Terf2 PE=2 SV=1
8	Q9PU53	8.17e-20	94.4	718	0.134	0.082	TERF2_CHICK Telomeric repeat-binding factor 2 OS=Gallus gallus OX=9031 GN=TERF2 PE=1 SV=2
9	A0A8I6A085	8.24e-20	92.0	318	0.137	0.189	A0A8I6A085_RAT Telomeric repeat binding factor 2 OS=Rattus norvegicus OX=10116 GN=Terf2 PE=1 SV=1
10	B1H237	1.08e-19	93.2	466	0.182	0.172	B1H237_RAT Terf2 protein OS=Rattus norvegicus OX=10116 GN=Terf2 PE=2 SV=1
11	Q15554	1.42e-19	93.2	542	0.137	0.111	TERF2_HUMAN Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3
12	H3BR06	9.89e-14	73.6	283	0.107	0.166	H3BR06_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
13	Q6T804	3.69e-07	54.3	426	0.068	0.070	Q6T804_ORYSJ ANTHER INDEHISCENCE1 OS=Oryza sativa subsp. japonica OX=39947 GN=AID1 PE=2 SV=1
14	F4I7K3	2.41e-05	48.9	624	0.055	0.038	F4I7K3_ARATH TRF-like 3 OS=Arabidopsis thaliana OX=3702 GN=TRFL3 PE=1 SV=1
15	Q8VWK4	1.39e-04	45.8	300	0.052	0.077	TRB1_ARATH Telomere repeat-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=TRB1 PE=1 SV=1
16	F4I7L1	1.41e-04	45.8	296	0.046	0.068	TRB4_ARATH Telomere repeat-binding factor 4 OS=Arabidopsis thaliana OX=3702 GN=At1g17520 PE=2 SV=2
17	F4IEY4	2.88e-04	45.1	287	0.043	0.066	TRB5_ARATH Telomere repeat-binding factor 5 OS=Arabidopsis thaliana OX=3702 GN=At1g72740 PE=2 SV=1
18	Q10274	6.80e-04	44.3	390	0.050	0.056	TEB1_SCHPO Telobox protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=teb1 PE=1 SV=1
19	Q6WS85	0.001	43.5	299	0.048	0.070	SMH1_MAIZE Single myb histone 1 OS=Zea mays OX=4577 GN=SMH1 PE=2 SV=1
20	Q9FJW5	0.002	42.4	299	0.048	0.070	TRB2_ARATH Telomere repeat-binding factor 2 OS=Arabidopsis thaliana OX=3702 GN=TRB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	2.4e-07	42.2	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	0.029	25.9	Myb-like DNA-binding domain
3	PF01535 PPR	5.3e+02	12.3	PPR repeat
4	PF08558 TRF	4.4e-32	123.2	Telomere repeat binding factor (TRF)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276603

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267415	0.999	TERF1-interacting nuclear factor 2
2	9606.ENSP00000311579	0.999	Tankyrase-1
3	9606.ENSP00000350249	0.999	Protection of telomeres protein 1
4	9606.ENSP00000483117	0.999	Adrenocortical dysplasia protein homolog
5	9606.ENSP00000463762	0.998	Telomere repeats-binding bouquet formation protein 1
6	9606.ENSP00000281623	0.997	F-box only protein 4
7	9606.ENSP00000318966	0.997	PIN2/TERF1-interacting telomerase inhibitor 1
8	9606.ENSP00000298139	0.996	Werner syndrome ATP-dependent helicase
9	9606.ENSP00000300086	0.994	Telomeric repeat-binding factor 2-interacting protein 1
10	9606.ENSP00000358576	0.991	5' exonuclease Apollo
11	9606.ENSP00000372689	0.990	Cohesin subunit SA-1
12	9606.ENSP00000309572	0.988	Telomerase reverse transcriptase
13	9606.ENSP00000360689	0.987	Tankyrase-2
14	9606.ENSP00000375978	0.983	X-ray repair cross-complementing protein 5
15	9606.ENSP00000305480	0.967	Flap endonuclease 1
16	9606.ENSP00000353332	0.966	Regulator of telomere elongation helicase 1
17	9606.ENSP00000352257	0.965	X-ray repair cross-complementing protein 6
18	9606.ENSP00000254942	0.964	Telomeric repeat-binding factor 2
19	9606.ENSP00000347232	0.955	Bloom syndrome protein
20	9606.ENSP00000328174	0.934	ATP-dependent DNA helicase PIF1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.999	protein homodimerization activity
GO:0003964	0.999	RNA-directed DNA polymerase activity
GO:0043047	0.999	single-stranded telomeric DNA binding
GO:0003691	0.998	double-stranded telomeric DNA binding
GO:0003720	0.994	telomerase activity
GO:0008301	0.976	DNA binding, bending
GO:0060090	0.973	molecular adaptor activity
GO:0008092	0.895	cytoskeletal protein binding
GO:0015631	0.890	tubulin binding
GO:0008017	0.856	microtubule binding
GO:0019904	0.803	protein domain specific binding
GO:0098505	0.556	G-rich strand telomeric DNA binding
GO:0071532	0.382	ankyrin repeat binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071704	0.979	organic substance metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0044238	0.977	primary metabolic process
GO:0050789	0.975	regulation of biological process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0000723	0.969	telomere maintenance
GO:0080090	0.968	regulation of primary metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0010556	0.962	regulation of macromolecule biosynthetic process
GO:0031326	0.962	regulation of cellular biosynthetic process
GO:0010605	0.961	negative regulation of macromolecule metabolic process
GO:0045934	0.960	negative regulation of nucleobase-containing compound metabolic process
GO:0032204	0.943	regulation of telomere maintenance
GO:2000278	0.939	regulation of DNA biosynthetic process
GO:0051053	0.939	negative regulation of DNA metabolic process
GO:0010639	0.921	negative regulation of organelle organization
GO:0050790	0.914	regulation of catalytic activity
GO:1904356	0.903	regulation of telomere maintenance via telomere lengthening
GO:2001251	0.898	negative regulation of chromosome organization
GO:0048518	0.878	positive regulation of biological process
GO:0048522	0.871	positive regulation of cellular process
GO:0034654	0.867	nucleobase-containing compound biosynthetic process
GO:0032210	0.865	regulation of telomere maintenance via telomerase
GO:0051338	0.841	regulation of transferase activity
GO:2000279	0.825	negative regulation of DNA biosynthetic process
GO:0010833	0.800	telomere maintenance via telomere lengthening
GO:0071897	0.782	DNA biosynthetic process
GO:0006278	0.725	RNA-templated DNA biosynthetic process
GO:0051972	0.689	regulation of telomerase activity
GO:0007004	0.689	telomere maintenance via telomerase
GO:0032069	0.687	regulation of nuclease activity
GO:0050896	0.626	response to stimulus
GO:0051130	0.615	positive regulation of cellular component organization
GO:0016233	0.443	telomere capping
GO:0009893	0.423	positive regulation of metabolic process
GO:0031325	0.413	positive regulation of cellular metabolic process
GO:0010604	0.364	positive regulation of macromolecule metabolic process
GO:0051173	0.359	positive regulation of nitrogen compound metabolic process
GO:0045935	0.340	positive regulation of nucleobase-containing compound metabolic process
GO:0022607	0.314	cellular component assembly
GO:0044087	0.306	regulation of cellular component biogenesis
GO:0010468	0.306	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0000781	0.986	chromosome, telomeric region
GO:0140513	0.973	nuclear protein-containing complex
GO:0032993	0.911	protein-DNA complex
GO:0044815	0.863	DNA packaging complex
GO:0005730	0.833	nucleolus
GO:0016604	0.804	nuclear body
GO:0140445	0.776	chromosome, telomeric repeat region
GO:0000783	0.772	nuclear telomere cap complex
GO:0005856	0.720	cytoskeleton
GO:0005737	0.717	cytoplasm
GO:0015630	0.712	microtubule cytoskeleton
GO:0005819	0.606	spindle
GO:0001650	0.404	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.49	0.999	RNA-directed DNA polymerase.

[back to server]