StarFunc result for job id P54277

User Input

>input (932 residues)
MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEG
IKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQ
YVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFG
ILKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSEESQIYLSGFL
PKCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKID
VPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVL
SKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGH
CSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGE
NEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMN
LNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLED
ATLQIEELWKTLSEEEKLKYEEKATKDLERYNSQMKRAIEQESQMSLKDGRKKIKPTSAW
NLAQKHKLKTSLSNQPKLDELLQSQIEKRRSQNIKMVQIPFSMKNLKINFKKQNKVDLEE
KDEPCLIHNLRFPDAWLMTSKTEVMLLNPYRVEEALLFKRLLENHKLPAEPLEKPIMLTE
SLFNGSHYLDVLYKMTADDQRYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMAN
CLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDI
IYRMKHQFGNEIKECVHGRPFFHHLTYLPETT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54277	1.000	1.000	0.000	932	1.000	1.000	P54277.pdb.gz	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
2	AFDB:Q6P7D0	0.357	0.362	0.000	919	0.733	0.743	Q6P7D0.pdb.gz	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
3	AFDB:Q8K119	0.385	0.391	0.000	917	0.747	0.759	Q8K119.pdb.gz	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
4	AFDB:F1NQJ3	0.345	0.369	2.442E-46	869	0.211	0.227	F1NQJ3.pdb.gz	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
5	AFDB:B1H246	0.342	0.373	1.297E-45	853	0.219	0.239	B1H246.pdb.gz	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
6	AFDB:P54278	0.340	0.366	3.317E-45	862	0.211	0.229	P54278.pdb.gz	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
7	AFDB:Q941I6	0.346	0.349	7.645E-45	923	0.224	0.226	Q941I6.pdb.gz	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
8	AFDB:P54280	0.341	0.398	1.942E-43	794	0.202	0.237	P54280.pdb.gz	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
9	AFDB:G5EFG5	0.341	0.393	2.271E-43	805	0.201	0.232	G5EFG5.pdb.gz	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
10	AFDB:P54279	0.339	0.367	3.801E-42	859	0.197	0.214	P54279.pdb.gz	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
11	PDB:7p8vA	0.330	0.894	1.156E-27	331	0.104	0.293	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
12	PDB:6rkwD	0.262	0.306	8.415E-12	781	0.052	0.061	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
13	PDB:7kclB	0.236	0.337	1.484E-10	614	0.060	0.091	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
14	PDB:2q2eB	0.237	0.362	3.795E-10	581	0.072	0.115	2q2eB.pdb.gz
15	PDB:5tthA	0.217	0.287	4.676E-10	671	0.050	0.070	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:5fwkA	0.242	0.340	1.816E-9	638	0.056	0.082	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
17	PDB:5tthB	0.228	0.323	1.816E-9	621	0.053	0.079	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
18	PDB:2zbkB	0.243	0.419	2.756E-9	506	0.056	0.103	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
19	PDB:2cg9B	0.225	0.321	3.972E-9	618	0.053	0.079	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
20	PDB:6zy7B	0.239	0.197	6.352E-9	1160	0.044	0.035	6zy7B.pdb.gz	Structural basis for allosteric regulation of Human Topoisomerase II alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AGZ9	0.0	1305	880	0.705	0.747	A0A8I6AGZ9_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=1
2	D4A651	0.0	1386	919	0.737	0.748	D4A651_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=3
3	E9Q8A5	0.0	972	669	0.536	0.747	E9Q8A5_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
4	P54277	0.0	1933	932	1.000	1.000	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
5	Q3US89	0.0	969	669	0.535	0.746	Q3US89_MOUSE HMG box domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=2 SV=1
6	Q6P7D0	0.0	1387	919	0.737	0.748	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
7	Q8K119	0.0	1395	917	0.747	0.759	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
8	D3Z0R7	1.66e-69	228	127	0.121	0.890	D3Z0R7_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
9	Q941I6	2.35e-50	194	923	0.128	0.129	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
10	F1NQJ3	1.43e-49	191	869	0.131	0.140	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
11	B1H246	1.61e-49	191	853	0.129	0.141	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
12	D4A360	1.67e-49	191	800	0.128	0.149	D4A360_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=2
13	A0A0G2JW47	2.98e-49	191	882	0.129	0.136	A0A0G2JW47_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
14	P54279	1.96e-48	188	859	0.126	0.136	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
15	P54278	1.90e-47	185	862	0.128	0.138	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
16	P54280	3.66e-47	183	794	0.126	0.147	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
17	D3Z611	4.35e-47	164	88	0.086	0.909	D3Z611_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
18	G5EFG5	1.03e-44	176	805	0.134	0.155	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
19	D3YX04	3.37e-42	150	80	0.078	0.912	D3YX04_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
20	P14242	1.75e-41	166	873	0.118	0.126	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01119 DNA_mis_repair	2.7e-23	93.3	DNA mismatch repair protein, C-terminal domain
2	PF02518 HATPase_c	0.0012	30.7	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	3.8e-07	41.6	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
4	PF00505 HMG_box	1.2e-10	52.9	HMG (high mobility group) box
5	PF09011 HMG_box_2	3.5e-07	42.0	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233146	0.998	DNA mismatch repair protein Msh2
2	9606.ENSP00000231790	0.991	DNA mismatch repair protein Mlh1
3	9606.ENSP00000234420	0.991	DNA mismatch repair protein Msh6
4	9606.ENSP00000265081	0.979	DNA mismatch repair protein Msh3
5	9606.ENSP00000355506	0.927	Exonuclease 1
6	9606.ENSP00000354497	0.916	Fanconi-associated nuclease 1
7	9606.ENSP00000364855	0.904	MutS protein homolog 5
8	9606.ENSP00000263187	0.895	MutS protein homolog 4
9	9606.ENSP00000406046	0.856	DNA polymerase delta catalytic subunit
10	9606.ENSP00000013807	0.835	DNA excision repair protein ERCC-1
11	9606.ENSP00000364270	0.813	DNA repair protein complementing XP-A cells
12	9606.ENSP00000347978	0.793	DNA repair protein complementing XP-G cells
13	9606.ENSP00000348020	0.773	DNA mismatch repair protein Mlh3
14	9606.ENSP00000278616	0.768	Serine-protein kinase ATM
15	9606.ENSP00000310520	0.749	DNA repair endonuclease XPF
16	9606.ENSP00000361170	0.743	Adenine DNA glycosylase
17	9606.ENSP00000285398	0.731	TFIIH basal transcription factor complex helicase XPB subunit
18	9606.ENSP00000265849	0.714	Mismatch repair endonuclease PMS2
19	9606.ENSP00000421491	0.709	DNA repair protein XRCC4
20	9606.ENSP00000484288	0.709	DNA ligase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0003677	1.000	DNA binding
GO:0003690	0.570	double-stranded DNA binding
GO:0003824	0.365	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0051716	0.996	cellular response to stimulus
GO:0006950	0.995	response to stress
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0006281	0.994	DNA repair
GO:0006298	0.938	mismatch repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.975	nuclear lumen
GO:0005654	0.974	nucleoplasm
GO:0032991	0.753	protein-containing complex
GO:0043232	0.505	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]