StarFunc result for job id P54278

User Input

>input (862 residues)
MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKD
YGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDV
TISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKE
YAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLI
PFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPA
KVCRLVNEVYHMYNRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSLI
GMFDSDVNKLNVSQQPLLDVEGNLIKMHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRL
REAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSSTSGAISDKGVLRPQKEAVSSSHG
PSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEYAASSPGDRGSQEHVDSQEKAP
KTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNTKRFKKEEILSSSDICQKLVNTQDM
SASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA
EDELRKEISKTMFAEMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQG
QRLIAPQTLNLTAVNEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGP
QDVDELIFMLSDSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP
WNCPHGRPTMRHIANLGVISQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1H246	0.603	0.609	0.000	853	0.768	0.776	B1H246.pdb.gz	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
2	AFDB:F1NQJ3	0.507	0.503	0.000	869	0.669	0.664	F1NQJ3.pdb.gz	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
3	AFDB:P54278	1.000	1.000	0.000	862	1.000	1.000	P54278.pdb.gz	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
4	AFDB:P54279	0.696	0.699	0.000	859	0.733	0.736	P54279.pdb.gz	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
5	AFDB:Q941I6	0.401	0.376	9.533E-70	923	0.363	0.339	Q941I6.pdb.gz	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
6	AFDB:G5EFG5	0.421	0.449	1.528E-69	805	0.327	0.350	G5EFG5.pdb.gz	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
7	AFDB:P14242	0.391	0.386	2.223E-66	873	0.340	0.336	P14242.pdb.gz	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
8	AFDB:P54277	0.372	0.345	1.255E-45	932	0.225	0.208	P54277.pdb.gz	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
9	AFDB:Q8K119	0.366	0.344	1.195E-44	917	0.235	0.221	Q8K119.pdb.gz	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
10	AFDB:Q6P7D0	0.370	0.348	1.649E-41	919	0.233	0.219	Q6P7D0.pdb.gz	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
11	PDB:7p8vA	0.355	0.887	5.795E-26	331	0.100	0.260	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
12	PDB:6rkwD	0.286	0.313	2.231E-11	781	0.066	0.073	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
13	PDB:7kclB	0.241	0.319	3.778E-10	614	0.075	0.106	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
14	PDB:5tthA	0.239	0.296	6.054E-10	671	0.078	0.100	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
15	PDB:5tthB	0.250	0.330	7.867E-10	621	0.070	0.097	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:2q2eB	0.262	0.370	3.237E-9	581	0.074	0.110	2q2eB.pdb.gz
17	PDB:2iopA	0.174	0.232	3.788E-9	618	0.051	0.071	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
18	PDB:2zbkB	0.238	0.378	3.788E-9	506	0.073	0.125	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
19	PDB:2cg9B	0.228	0.300	4.923E-9	618	0.063	0.087	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
20	PDB:1y4uB	0.144	0.244	5.467E-9	454	0.050	0.095	1y4uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW47	0.0	1315	882	0.768	0.751	A0A0G2JW47_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
2	A0A2R8Y6S3	0.0	1519	727	0.843	1.000	A0A2R8Y6S3_HUMAN PMS1 homolog 2, mismatch repair system component OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=1
3	B1H246	0.0	1330	853	0.768	0.776	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
4	C9J167	0.0	1555	756	0.864	0.985	C9J167_HUMAN PMS1 homolog 2, mismatch repair system component OS=Homo sapiens OX=9606 GN=PMS2 PE=3 SV=2
5	D4A360	0.0	1047	800	0.618	0.666	D4A360_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=2
6	F1NQJ3	0.0	1136	869	0.673	0.667	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
7	P54278	0.0	1792	862	1.000	1.000	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
8	P54279	0.0	1359	859	0.780	0.782	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
9	A0A8I5ZND0	5.80e-160	476	461	0.275	0.514	A0A8I5ZND0_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
10	Q941I6	3.72e-99	332	923	0.191	0.179	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
11	G5EFG5	3.08e-91	308	805	0.168	0.180	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
12	P14242	8.94e-82	283	873	0.174	0.172	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
13	P54280	3.51e-81	280	794	0.171	0.185	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
14	P54277	1.44e-47	185	932	0.138	0.128	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
15	Q3US89	2.36e-47	182	669	0.135	0.173	Q3US89_MOUSE HMG box domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=2 SV=1
16	E9Q8A5	2.41e-47	182	669	0.135	0.173	E9Q8A5_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
17	Q8K119	4.06e-46	181	917	0.133	0.125	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
18	Q6P7D0	5.27e-46	180	919	0.132	0.124	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
19	D4A651	6.97e-46	180	919	0.132	0.124	D4A651_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=3
20	A0A669KBK2	4.67e-44	171	633	0.138	0.188	A0A669KBK2_HUMAN MutL homolog 1 OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01119 DNA_mis_repair	4e-20	83.1	DNA mismatch repair protein, C-terminal domain
2	PF02518 HATPase_c	0.012	27.5	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	7.8e-09	47.0	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
4	PF07661 MORN_2	5.1e+02	12.4	MORN repeat variant
5	PF08676 MutL_C	2.4e-27	106.9	MutL C terminal dimerisation domain
6	PF04034 Ribo_biogen_C	4.7e+02	11.9	Ribosome biogenesis protein, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.999	DNA mismatch repair protein Mlh1
2	9606.ENSP00000233146	0.999	DNA mismatch repair protein Msh2
3	9606.ENSP00000234420	0.999	DNA mismatch repair protein Msh6
4	9606.ENSP00000265081	0.996	DNA mismatch repair protein Msh3
5	9606.ENSP00000355506	0.995	Exonuclease 1
6	9606.ENSP00000259008	0.980	Fanconi anemia group J protein
7	9606.ENSP00000354497	0.974	Fanconi-associated nuclease 1
8	9606.ENSP00000269305	0.966	Cellular tumor antigen p53
9	9606.ENSP00000406046	0.957	DNA polymerase delta catalytic subunit
10	9606.ENSP00000223129	0.923	Replication protein A 14 kDa subunit
11	9606.ENSP00000254719	0.922	Replication protein A 70 kDa DNA-binding subunit
12	9606.ENSP00000363017	0.908	Replication protein A 32 kDa subunit
13	9606.ENSP00000013807	0.907	DNA excision repair protein ERCC-1
14	9606.ENSP00000418960	0.907	Breast cancer type 1 susceptibility protein
15	9606.ENSP00000364270	0.904	DNA repair protein complementing XP-A cells
16	9606.ENSP00000364855	0.902	MutS protein homolog 5
17	9606.ENSP00000322570	0.901	DNA polymerase epsilon catalytic subunit A
18	9606.ENSP00000263187	0.895	MutS protein homolog 4
19	9606.ENSP00000368458	0.895	Proliferating cell nuclear antigen
20	9606.ENSP00000313420	0.876	DNA-dependent protein kinase catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0004519	1.000	endonuclease activity
GO:0003697	1.000	single-stranded DNA binding
GO:0030983	1.000	mismatched DNA binding
GO:0032135	0.955	DNA insertion or deletion binding
GO:0032407	0.870	MutSalpha complex binding
GO:0032138	0.862	single base insertion or deletion binding
GO:0043565	0.352	sequence-specific DNA binding
GO:0043167	0.332	ion binding
GO:1990837	0.306	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006974	0.988	cellular response to DNA damage stimulus
GO:0006807	0.987	nitrogen compound metabolic process
GO:0006259	0.978	DNA metabolic process
GO:0006281	0.961	DNA repair
GO:0006298	0.799	mismatch repair
GO:0065007	0.568	biological regulation
GO:0050789	0.538	regulation of biological process
GO:0050794	0.517	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0016020	0.998	membrane
GO:0005829	0.998	cytosol
GO:0005886	0.990	plasma membrane
GO:0032991	0.946	protein-containing complex
GO:0035770	0.932	ribonucleoprotein granule
GO:0036464	0.914	cytoplasmic ribonucleoprotein granule
GO:0140513	0.415	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]