StarFunc result for job id P54284

User Input

>input (484 residues)
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWP
KDSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54284	1.000	1.000	1.566E-90	484	1.000	1.000	P54284.pdb.gz	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
2	AFDB:O00305	0.701	0.653	4.133E-63	520	0.682	0.635	O00305.pdb.gz	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
3	AFDB:B0F0D0	0.680	0.636	4.482E-60	519	0.657	0.613	B0F0D0.pdb.gz	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
4	AFDB:B0F0D1	0.666	0.618	1.408E-59	523	0.657	0.608	B0F0D1.pdb.gz	B0F0D1_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
5	AFDB:Q02641	0.669	0.543	4.366E-58	598	0.614	0.497	Q02641.pdb.gz	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
6	AFDB:B2XY77	0.675	0.548	3.820E-57	599	0.583	0.471	B2XY77.pdb.gz
7	AFDB:Q2Q551	0.644	0.520	8.359E-57	603	0.601	0.483	Q2Q551.pdb.gz	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
8	AFDB:Q08289	0.659	0.487	1.002E-56	660	0.634	0.465	Q08289.pdb.gz	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
9	AFDB:B2XY76	0.662	0.507	5.095E-56	637	0.570	0.433	B2XY76.pdb.gz
10	AFDB:O01661	0.653	0.602	3.213E-53	526	0.525	0.483	O01661.pdb.gz	O01661_CAEEL Guanylate kinase/L-type calcium channel beta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccb-1 PE=1 SV=2
11	PDB:7mixC	0.593	0.871	6.448E-51	324	0.667	0.997	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
12	PDB:6jpaC	0.364	0.980	1.509E-23	178	0.312	0.848	6jpaC.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
13	PDB:2xkxA	0.232	0.164	2.188E-10	721	0.134	0.090	2xkxA.pdb.gz
14	PDB:1lvgA	0.257	0.585	2.769E-5	190	0.081	0.205	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
15	PDB:4f4jA	0.255	0.590	2.941E-5	189	0.068	0.175	4f4jA.pdb.gz
16	PDB:6nuiA	0.267	0.581	3.317E-5	198	0.076	0.187	6nuiA.pdb.gz
17	PDB:1z8fA	0.240	0.552	4.483E-5	184	0.076	0.201	1z8fA.pdb.gz
18	PDB:1z6gA	0.254	0.578	1.904E-4	191	0.066	0.168	1z6gA.pdb.gz
19	PDB:3qwyA	0.107	0.293	2.391E-3	170	0.031	0.088	3qwyA.pdb.gz
20	PDB:1e2fA	0.223	0.426	3.231E-3	210	0.052	0.119	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2SZ54	543	598	0.564	0.457	A2SZ54_DANRE Voltage-dependent L-type calcium channel subunit beta-2 OS=Danio rerio OX=7955 GN=cacnb2b PE=2 SV=1
2	A8WHZ5	580	485	0.678	0.676	A8WHZ5_DANRE Voltage-dependent L-type calcium channel subunit beta-3 OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
3	B0F0C6	575	489	0.674	0.667	B0F0C6_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
4	B0F0D0	558	519	0.655	0.611	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
5	B0F0D1	552	523	0.651	0.602	B0F0D1_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
6	D4A055	614	519	0.671	0.626	CACB4_RAT Voltage-dependent L-type calcium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Cacnb4 PE=1 SV=2
7	O00305	615	520	0.674	0.627	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
8	P54283	538	597	0.556	0.451	CACB1_RAT Voltage-dependent L-type calcium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Cacnb1 PE=1 SV=1
9	P54284	996	484	1.000	1.000	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
10	P54285	988	484	0.992	0.992	CACB3_MOUSE Voltage-dependent L-type calcium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Cacnb3 PE=1 SV=2
11	P54287	990	484	0.992	0.992	CACB3_RAT Voltage-dependent L-type calcium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Cacnb3 PE=1 SV=1
12	P54288	545	632	0.651	0.498	CACB2_RABIT Voltage-dependent L-type calcium channel subunit beta-2 OS=Oryctolagus cuniculus OX=9986 GN=CACNB2 PE=1 SV=1
13	Q02641	541	598	0.558	0.452	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
14	Q08289	541	660	0.649	0.476	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
15	Q2Q551	527	603	0.548	0.439	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
16	Q6DG31	530	478	0.548	0.554	Q6DG31_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
17	Q8CC27	539	655	0.657	0.485	CACB2_MOUSE Voltage-dependent L-type calcium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Cacnb2 PE=1 SV=1
18	Q8R0S4	614	519	0.671	0.626	CACB4_MOUSE Voltage-dependent L-type calcium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Cacnb4 PE=1 SV=2
19	Q8R3Z5	539	597	0.556	0.451	CACB1_MOUSE Voltage-dependent L-type calcium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Cacnb1 PE=1 SV=1
20	Q8VGC3	547	655	0.657	0.485	CACB2_RAT Voltage-dependent L-type calcium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Cacnb2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19901 DUF6374	1.7e+02	13.2	Family of unknown function (DUF6374)
2	PF00625 Guanylate_kin	1.4e-42	156.9	Guanylate kinase
3	PF00018 SH3_1	3.9e+02	12.1	SH3 domain
4	PF12052 VGCC_beta4Aa_N	2.5e-15	67.6	Voltage gated calcium channel subunit beta domain 4Aa N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266376	0.992	Voltage-dependent L-type calcium channel subunit alpha-1C
2	9606.ENSP00000288139	0.987	Voltage-dependent L-type calcium channel subunit alpha-1D
3	9606.ENSP00000372169	0.984	Voltage-dependent calcium channel subunit alpha-2/delta-4
4	9606.ENSP00000349320	0.976	Voltage-dependent calcium channel subunit alpha-2/delta-1
5	9606.ENSP00000365441	0.976	Voltage-dependent L-type calcium channel subunit alpha-1F
6	9606.ENSP00000360423	0.974	Voltage-dependent N-type calcium channel subunit alpha-1B
7	9606.ENSP00000355192	0.965	Voltage-dependent L-type calcium channel subunit alpha-1S
8	9606.ENSP00000005284	0.955	Voltage-dependent calcium channel gamma-3 subunit
9	9606.ENSP00000438949	0.945	Voltage-dependent L-type calcium channel subunit beta-4
10	9606.ENSP00000356545	0.941	Voltage-dependent R-type calcium channel subunit alpha-1E
11	9606.ENSP00000262138	0.936	Voltage-dependent calcium channel gamma-4 subunit
12	9606.ENSP00000270458	0.931	Voltage-dependent calcium channel gamma-8 subunit
13	9606.ENSP00000375647	0.924	Voltage-dependent calcium channel gamma-7 subunit
14	9606.ENSP00000320025	0.916	Voltage-dependent L-type calcium channel subunit beta-2
15	9606.ENSP00000222812	0.915	Syntaxin-1A
16	9606.ENSP00000346265	0.915	Synaptotagmin-5
17	9606.ENSP00000254976	0.914	Synaptosomal-associated protein 25
18	9606.ENSP00000252729	0.910	Voltage-dependent calcium channel gamma-6 subunit
19	9606.ENSP00000362399	0.907	Syntaxin-binding protein 1
20	9606.ENSP00000380432	0.907	Insulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.972	biological regulation
GO:0009987	0.931	cellular process
GO:0050789	0.924	regulation of biological process
GO:0050794	0.907	regulation of cellular process
GO:0050896	0.829	response to stimulus
GO:0006812	0.814	monoatomic cation transport
GO:0030001	0.781	metal ion transport
GO:0006816	0.772	calcium ion transport
GO:0007154	0.709	cell communication
GO:0032501	0.688	multicellular organismal process
GO:0023052	0.623	signaling
GO:0051716	0.484	cellular response to stimulus
GO:0032879	0.396	regulation of localization
GO:0007165	0.393	signal transduction
GO:0051049	0.305	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005891	1.000	voltage-gated calcium channel complex
GO:0005622	0.610	intracellular anatomical structure
GO:0005737	0.592	cytoplasm
GO:0005829	0.531	cytosol
GO:0043226	0.510	organelle
GO:0043227	0.341	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]