StarFunc result for job id P54289

User Input

>input (1103 residues)
MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDI
YEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASN
EVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVL
NELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRR
RPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIML
FTDGGEERAQEIFNKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLK
NQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTIN
LRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
DKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTF
IAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQNYW
SKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYF
NKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCD
CKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDY
QSVCEPGAAPKQGAGHRSAYVPSVADILQIGWWATAAAWSILQQFLLSLTFPRLLEAVEM
EDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHGEKLMNTNLIFIMVES
KGTCPCDTRLLIQAEQTSDGPNPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPS
LWYIIGIQFLLLWLVSGSTHRLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6jp8F	0.880	0.998	0.000	973	0.868	0.984	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
2	AFDB:A0A2R8QDT8	0.890	0.873	0.000	1125	0.621	0.609	A0A2R8QDT8.pdb.gz
3	AFDB:E7F4T2	0.922	0.932	0.000	1091	0.620	0.627	E7F4T2.pdb.gz	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
4	AFDB:P13806	0.987	0.984	0.000	1106	0.966	0.963	P13806.pdb.gz	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
5	AFDB:P54290	0.962	0.973	0.000	1091	0.937	0.947	P54290.pdb.gz	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
6	AFDB:Q8CFG6	0.875	0.836	0.000	1157	0.525	0.500	Q8CFG6.pdb.gz	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
7	AFDB:Q7Z3S7	0.757	0.736	5.819E-84	1137	0.277	0.269	Q7Z3S7.pdb.gz	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
8	AFDB:Q8CFG5	0.748	0.759	2.072E-83	1085	0.278	0.283	Q8CFG5.pdb.gz	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
9	AFDB:F1QYJ5	0.754	0.765	4.830E-83	1087	0.268	0.272	F1QYJ5.pdb.gz
10	AFDB:A0A0B4K7P4	0.744	0.668	3.788E-78	1237	0.277	0.247	A0A0B4K7P4.pdb.gz	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
11	AFDB:Q8IP22	0.750	0.686	2.976E-75	1215	0.264	0.240	Q8IP22.pdb.gz	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
12	PDB:7ad8D	0.135	0.481	6.593E-7	280	0.028	0.111	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
13	PDB:6gym6	0.139	0.430	1.709E-6	335	0.020	0.066	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
14	PDB:4nehA	0.123	0.125	3.584E-6	1084	0.041	0.042	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
15	PDB:7zs96	0.140	0.379	4.924E-6	383	0.025	0.073	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:1m2vA	0.124	0.186	1.210E-5	705	0.048	0.075	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
17	PDB:7ena2	0.135	0.358	1.663E-5	385	0.029	0.083	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:4nenA	0.133	0.138	1.949E-5	1063	0.038	0.040	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
19	PDB:6gvwD	0.122	0.459	1.949E-5	239	0.025	0.117	6gvwD.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
20	PDB:1jeqA	0.118	0.217	2.975E-5	548	0.055	0.111	1jeqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F4T2	0.0	1354	1091	0.612	0.619	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
2	O08532	0.0	2227	1103	0.965	0.965	CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1
3	P13806	0.0	2223	1106	0.975	0.972	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
4	P54289	0.0	2289	1103	1.000	1.000	CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3
5	P54290	0.0	2117	1091	0.938	0.949	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
6	Q5TZ68	0.0	1355	1069	0.609	0.629	Q5TZ68_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
7	Q6PHS9	0.0	1167	1154	0.529	0.505	CA2D2_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Mus musculus OX=10090 GN=Cacna2d2 PE=1 SV=1
8	Q8CFG6	0.0	1154	1157	0.526	0.501	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
9	Q9NY47	0.0	1172	1150	0.532	0.510	CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2
10	Q8CFG5	4.68e-122	403	1085	0.286	0.290	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
11	Q7Z3S7	1.93e-117	392	1137	0.282	0.274	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
12	Q7K0H4	7.66e-98	339	1218	0.254	0.230	Q7K0H4_DROME SD07723p OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
13	A0A0B4K7P4	3.62e-92	323	1237	0.255	0.227	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
14	Q8IP22	9.98e-89	313	1215	0.248	0.225	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
15	A0A0B4K866	2.75e-88	312	1271	0.254	0.220	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
16	X2J9Z3	1.24e-68	254	1271	0.165	0.143	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
17	G4S4A1	1.08e-62	235	1205	0.246	0.225	G4S4A1_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=1
18	P34374	5.22e-58	221	1249	0.247	0.218	UNC36_CAEEL Voltage-dependent calcium channel unc-36 OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=2
19	Q95R75	1.29e-41	167	842	0.154	0.202	Q95R75_DROME SD03196p OS=Drosophila melanogaster OX=7227 GN=stj PE=2 SV=1
20	Q61704	5.62e-09	62.8	889	0.048	0.060	ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus OX=10090 GN=Itih3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02743 dCache_1	0.0095	27.0	Cache domain
2	PF00714 IFN-gamma	3.2e+02	12.6	Interferon gamma
3	PF08473 VGCC_alpha2	1.9e-213	720.7	Neuronal voltage-dependent calcium channel alpha 2acd
4	PF00092 VWA	1.1e-11	56.8	von Willebrand factor type A domain
5	PF13519 VWA_2	4.4e-08	45.1	von Willebrand factor type A domain
6	PF13768 VWA_3	6.3e-12	57.2	von Willebrand factor type A domain
7	PF08399 VWA_N	4.3e-34	129.1	VWA N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010386220.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010362319.1	0.999	Voltage-dependent L-type calcium channel subunit beta-2 isoform X1
2	61622.XP_010377628.1	0.999	Calcium voltage-gated channel auxiliary subunit beta 1
3	61622.XP_010378285.1	0.998	Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents in skeletal muscle. Regulates channel inactivation kinetics
4	61622.XP_010360980.1	0.996	Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death
5	61622.XP_010383735.1	0.992	Voltage-dependent L-type calcium channel subunit beta-3 isoform X1
6	61622.XP_010370916.1	0.982	Voltage-dependent N-type calcium channel subunit alpha-1B
7	61622.XP_010371204.1	0.981	Voltage-dependent L-type calcium channel subunit beta-4 isoform X1
8	61622.XP_010374490.1	0.981	Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death
9	61622.XP_010360009.1	0.977	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
10	61622.XP_010357495.1	0.972	Voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
11	61622.XP_010361873.1	0.972	Voltage-dependent L-type calcium channel subunit alpha-1C-like
12	61622.XP_010367204.1	0.969	Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1E gives rise to R-type calcium currents
13	61622.XP_010360912.1	0.966	Voltage-dependent L-type calcium channel subunit alpha-1F
14	61622.XP_010379007.1	0.941	Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (By similarity). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Shows specificity only for GRIA1 and GRIA2.
15	61622.XP_010379041.1	0.941	Voltage-dependent calcium channel gamma-8 subunit
16	61622.XP_010378390.1	0.940	Voltage-dependent calcium channel gamma-4 subunit
17	61622.XP_010379005.1	0.925	Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit.
18	61622.XP_010366178.1	0.921	Calcium voltage-gated channel auxiliary subunit gamma 3
19	61622.XP_010361867.1	0.916	Voltage-dependent calcium channel subunit alpha-2/delta-4
20	61622.XP_010384028.1	0.889	Ryanodine receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0098772	0.856	molecular function regulator activity
GO:0099106	0.785	ion channel regulator activity
GO:0005246	0.737	calcium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.992	cellular process
GO:0010959	0.989	regulation of metal ion transport
GO:0051924	0.982	regulation of calcium ion transport
GO:0050794	0.979	regulation of cellular process
GO:0006810	0.963	transport
GO:0006816	0.949	calcium ion transport
GO:0008016	0.946	regulation of heart contraction
GO:0034762	0.931	regulation of transmembrane transport
GO:0042391	0.895	regulation of membrane potential
GO:1904062	0.886	regulation of monoatomic cation transmembrane transport
GO:0098655	0.870	monoatomic cation transmembrane transport
GO:0098662	0.869	inorganic cation transmembrane transport
GO:0032501	0.810	multicellular organismal process
GO:1903169	0.765	regulation of calcium ion transmembrane transport
GO:0050896	0.753	response to stimulus
GO:0070588	0.744	calcium ion transmembrane transport
GO:0003008	0.664	system process
GO:0007154	0.648	cell communication
GO:0097553	0.623	calcium ion transmembrane import into cytosol
GO:0048518	0.613	positive regulation of biological process
GO:0006936	0.581	muscle contraction
GO:0051716	0.521	cellular response to stimulus
GO:0023052	0.492	signaling
GO:0065009	0.429	regulation of molecular function
GO:0001508	0.428	action potential
GO:0061337	0.422	cardiac conduction
GO:0032409	0.396	regulation of transporter activity
GO:0003015	0.396	heart process
GO:0086001	0.396	cardiac muscle cell action potential
GO:0006941	0.388	striated muscle contraction
GO:0060047	0.381	heart contraction
GO:0060048	0.371	cardiac muscle contraction
GO:0042221	0.364	response to chemical
GO:0070252	0.350	actin-mediated cell contraction
GO:0002027	0.336	regulation of heart rate
GO:0086065	0.320	cell communication involved in cardiac conduction
GO:0051899	0.315	membrane depolarization
GO:0098657	0.300	import into cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005891	0.999	voltage-gated calcium channel complex
GO:0030315	0.971	T-tubule
GO:0043227	0.950	membrane-bounded organelle
GO:0005622	0.884	intracellular anatomical structure
GO:0031982	0.704	vesicle
GO:0043229	0.586	intracellular organelle
GO:0005737	0.579	cytoplasm
GO:0043231	0.564	intracellular membrane-bounded organelle
GO:1990454	0.493	L-type voltage-gated calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]