StarFunc result for job id P54296

User Input

>input (1465 residues)
MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQ
TSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARS
QARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGF
PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST
NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT
MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR
GGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD
RCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDP
LDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKD
PLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT
SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN
HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL
NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL
YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG
SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD
TSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIET
VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS
ELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRF
SIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDV
TEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKA
TLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEM
KVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSG
QAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK
NDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGE
KIPDMAPPQQAKPKLIPASASAAGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K5P5	0.187	0.164	0.000	1688	0.463	0.402	A0A0G2K5P5.pdb.gz	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
2	AFDB:A2ABU4	0.172	0.176	0.000	1439	0.399	0.407	A2ABU4.pdb.gz	MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 PE=1 SV=1
3	AFDB:G3V7K1	0.311	0.311	0.000	1464	0.889	0.890	G3V7K1.pdb.gz	G3V7K1_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=2
4	AFDB:P52179	0.239	0.214	0.000	1685	0.458	0.398	P52179.pdb.gz	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
5	AFDB:P54296	1.000	1.000	0.000	1465	1.000	1.000	P54296.pdb.gz	MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 PE=1 SV=3
6	AFDB:Q5VTT5	0.210	0.214	0.000	1437	0.406	0.414	Q5VTT5.pdb.gz	MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 PE=1 SV=1
7	AFDB:Q62234	0.201	0.180	0.000	1667	0.461	0.405	Q62234.pdb.gz	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
8	AFDB:O75147	0.099	0.083	5.804E-54	1896	0.138	0.107	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
9	AFDB:D3ZZ80	0.117	0.100	2.761E-53	1805	0.141	0.114	D3ZZ80.pdb.gz	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
10	AFDB:Q8AV57	0.117	0.086	4.099E-51	2177	0.161	0.108	Q8AV57.pdb.gz	SDK2_CHICK Protein sidekick-2 OS=Gallus gallus OX=9031 GN=SDK2 PE=1 SV=2
11	PDB:5oj2B	0.083	0.140	2.673E-17	692	0.070	0.149	5oj2B.pdb.gz
12	PDB:1e07A	0.075	0.130	1.394E-16	642	0.063	0.145	1e07A.pdb.gz
13	PDB:6pxvA	0.094	0.150	1.707E-13	823	0.040	0.072	6pxvA.pdb.gz
14	PDB:7sqcO0	0.065	0.080	1.172E-12	1140	0.083	0.106	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:8dtlA	0.090	0.152	2.033E-12	741	0.041	0.081	8dtlA.pdb.gz
16	PDB:5a42A	0.087	0.081	4.642E-12	1597	0.085	0.078	5a42A.pdb.gz
17	PDB:7q1yA	0.065	0.068	7.345E-12	1374	0.060	0.064	7q1yA.pdb.gz
18	PDB:7q5zA	0.067	0.072	9.672E-12	1344	0.068	0.074	7q5zA.pdb.gz
19	PDB:8eyyA	0.088	0.145	3.188E-11	775	0.041	0.077	8eyyA.pdb.gz
20	PDB:6pyhD	0.090	0.145	5.044E-11	798	0.044	0.080	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5P5	0.0	660	1676	0.317	0.277	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
2	A0A8I6AC90	0.0	2721	1541	0.889	0.846	A0A8I6AC90_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=1
3	A0A8I6GBP8	0.0	662	1689	0.319	0.277	A0A8I6GBP8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
4	A0A8I6GFM8	0.0	1367	1592	0.470	0.432	A0A8I6GFM8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
5	A2ABU4	0.0	1108	1439	0.392	0.400	MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 PE=1 SV=1
6	E1BF23	0.0	2725	1495	0.877	0.860	E1BF23_BOVIN Myomesin 2 OS=Bos taurus OX=9913 GN=MYOM2 PE=4 SV=3
7	F1N9Z6	0.0	1404	1587	0.461	0.426	F1N9Z6_CHICK Myomesin 1 OS=Gallus gallus OX=9031 GN=MYOM1 PE=4 SV=4
8	G3V7K1	0.0	2698	1472	0.885	0.880	G3V7K1_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=2
9	O55124	0.0	2738	1463	0.885	0.887	O55124_MOUSE M-protein OS=Mus musculus OX=10090 GN=Myom2 PE=2 SV=1
10	P52179	0.0	654	1685	0.241	0.209	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
11	P54296	0.0	3058	1465	0.999	0.999	MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 PE=1 SV=3
12	Q14BI5	0.0	2761	1463	0.892	0.893	Q14BI5_MOUSE Myomesin 2 OS=Mus musculus OX=10090 GN=Myom2 PE=1 SV=1
13	Q3UQS9	0.0	2759	1463	0.892	0.893	Q3UQS9_MOUSE Myomesin-2 OS=Mus musculus OX=10090 GN=Myom2 PE=2 SV=1
14	Q5VTT5	0.0	1118	1437	0.399	0.406	MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 PE=1 SV=1
15	Q62234	0.0	601	1667	0.197	0.173	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
16	A2ASS6	1.22e-72	272	35213	0.158	0.007	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
17	A0A8I5ZUN3	1.81e-72	271	35375	0.158	0.007	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
18	A0A8I5ZU83	2.00e-72	271	26931	0.158	0.009	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	Q80UL0	5.78e-72	237	118	0.074	0.924	Q80UL0_RAT Myomesin 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Myom2 PE=2 SV=1
20	Q8WZ42	7.63e-71	266	34350	0.155	0.007	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1.5e+02	13.5	Adenovirus E3 region protein CR1
2	PF06832 BiPBP_C	1.5e+02	13.9	Penicillin-Binding Protein C-terminus Family
3	PF08205 C2-set_2	0.0018	29.6	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	2.1e-82	282.9	Fibronectin type III domain
5	PF07679 I-set	1.2e-64	225.7	Immunoglobulin I-set domain
6	PF00047 ig	1e-23	94.7	Immunoglobulin domain
7	PF13895 Ig_2	1.6e-24	97.3	Immunoglobulin domain
8	PF13927 Ig_3	2.4e-43	157.9	Immunoglobulin domain
9	PF16656 Pur_ac_phosph_N	2.9e-09	48.8	Purple acid Phosphatase, N-terminal domain
10	PF11465 Receptor_2B4	0.011	27.3	Natural killer cell receptor 2B4
11	PF07686 V-set	3.6e-13	61.0	Immunoglobulin V-set domain
12	PF07495 Y_Y_Y	27	16.1	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262113

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308938	0.987	Plasminogen
2	9606.ENSP00000295897	0.982	Serum albumin
3	9606.ENSP00000313875	0.970	Membrane cofactor protein
4	9606.ENSP00000316032	0.963	Nuclear pore complex protein Nup98-Nup96
5	9606.ENSP00000221476	0.927	Creatine kinase M-type
6	9606.ENSP00000424827	0.886	E3 ubiquitin-protein ligase NEDD4
7	9606.ENSP00000454207	0.855	TNF receptor-associated factor 3
8	9606.ENSP00000306997	0.852	Myozenin-2
9	9606.ENSP00000356399	0.826	Complement factor H
10	9606.ENSP00000430684	0.826	Inhibitor of nuclear factor kappa-B kinase subunit beta
11	9606.ENSP00000352272	0.817	Myozenin-1
12	9606.ENSP00000396688	0.816	Complement C4-A
13	9606.ENSP00000467141	0.814	Titin
14	9606.ENSP00000255381	0.786	Myosin-4
15	9606.ENSP00000341940	0.786	Caveolin-3
16	9606.ENSP00000394770	0.782	Cardiomyopathy-associated protein 5
17	9606.ENSP00000368808	0.765	Small muscular protein
18	9606.ENSP00000261448	0.743	Calsequestrin-2
19	9606.ENSP00000383931	0.741	Platelet glycoprotein V
20	9606.ENSP00000378289	0.732	Synaptopodin 2-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008307	0.999	structural constituent of muscle
GO:0005515	0.999	protein binding
GO:0019899	0.906	enzyme binding
GO:0019900	0.867	kinase binding
GO:0008092	0.321	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0003012	0.961	muscle system process
GO:0006936	0.918	muscle contraction
GO:0048856	0.703	anatomical structure development
GO:0009987	0.682	cellular process
GO:0050789	0.389	regulation of biological process
GO:0061061	0.382	muscle structure development
GO:0050794	0.317	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0099512	0.995	supramolecular fiber
GO:0030016	0.991	myofibril
GO:0030017	0.974	sarcomere
GO:0031430	0.958	M band
GO:0005856	0.892	cytoskeleton
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0005829	0.475	cytosol
GO:0005739	0.403	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]