StarFunc result for job id P54368

User Input

>input (228 residues)
MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNP
GPGPRWCSDAPHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQS
RLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNR
EDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54368	1.000	1.000	3.132E-43	228	1.000	1.000	P54368.pdb.gz	OAZ1_HUMAN Ornithine decarboxylase antizyme 1 OS=Homo sapiens OX=9606 GN=OAZ1 PE=1 SV=3
2	AFDB:P54369	0.737	0.740	2.474E-37	227	0.838	0.841	P54369.pdb.gz	OAZ1_MOUSE Ornithine decarboxylase antizyme 1 OS=Mus musculus OX=10090 GN=Oaz1 PE=1 SV=3
3	AFDB:O08608	0.580	0.693	3.354E-21	189	0.430	0.519	O08608.pdb.gz	OAZ2_MOUSE Ornithine decarboxylase antizyme 2 OS=Mus musculus OX=10090 GN=Oaz2 PE=1 SV=2
4	AFDB:A1BPI0	0.549	0.517	7.927E-15	243	0.224	0.210	A1BPI0.pdb.gz	OAZ3_RAT Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1
5	AFDB:A8MW57	0.566	0.550	1.750E-14	235	0.228	0.221	A8MW57.pdb.gz	A8MW57_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
6	AFDB:P54361	0.434	0.392	2.805E-10	254	0.241	0.217	P54361.pdb.gz	OAZ_DROME Ornithine decarboxylase antizyme OS=Drosophila melanogaster OX=7227 GN=Oda PE=2 SV=2
7	PDB:2g3aA	0.317	0.487	8.019E-4	137	0.083	0.139	2g3aA.pdb.gz
8	PDB:2ob0C	0.270	0.352	8.523E-4	166	0.092	0.127	2ob0C.pdb.gz	Structure of Human MAK3 homolog
9	PDB:3owcA	0.304	0.383	1.228E-3	172	0.070	0.093	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
10	PDB:4r9mA	0.323	0.414	1.665E-3	169	0.061	0.083	4r9mA.pdb.gz	Analysis of crystalline and solution states of ligand-free spermidine N-acetyltransferase (SpeG) from Escherichia coli.
11	PDB:2vzyC	0.309	0.361	1.770E-3	189	0.101	0.122	2vzyC.pdb.gz	Rv0802C from Mycobacterium Tuberculosis: The First Structure of a Succinyltransferase with the Gnat Fold.
12	PDB:2vzzA	0.287	0.308	1.999E-3	210	0.088	0.095	2vzzA.pdb.gz	Rv0802C from Mycobacterium Tuberculosis: The First Structure of a Succinyltransferase with the Gnat Fold.
13	PDB:1tiqA	0.323	0.406	4.689E-3	173	0.088	0.116	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
14	PDB:2z0zA	0.305	0.345	5.629E-3	194	0.092	0.108	2z0zA.pdb.gz
15	AFDB:O14617	0.146	0.037	5.936E-3	1153	0.162	0.032	O14617.pdb.gz	AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1
16	PDB:5isvA	0.330	0.458	6.358E-3	156	0.101	0.147	5isvA.pdb.gz
17	PDB:5c88A	0.236	0.319	7.181E-3	158	0.066	0.095	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
18	AFDB:P91926	0.124	0.043	1.671E-2	940	0.132	0.032	P91926.pdb.gz	AP2A_DROME AP-2 complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=AP-2alpha PE=1 SV=1
19	AFDB:Q54WN0	0.123	0.035	1.776E-2	1143	0.132	0.026	Q54WN0.pdb.gz	AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum OX=44689 GN=ap3d1 PE=3 SV=1
20	AFDB:Q9UPM8	0.159	0.050	2.006E-2	1137	0.149	0.030	Q9UPM8.pdb.gz	AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens OX=9606 GN=AP4E1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54368	1.46e-170	470	228	1.000	1.000	OAZ1_HUMAN Ornithine decarboxylase antizyme 1 OS=Homo sapiens OX=9606 GN=OAZ1 PE=1 SV=3
2	P54370	1.79e-143	401	227	0.838	0.841	OAZ1_RAT Ornithine decarboxylase antizyme 1 OS=Rattus norvegicus OX=10116 GN=Oaz1 PE=1 SV=3
3	P54369	2.35e-143	401	227	0.838	0.841	OAZ1_MOUSE Ornithine decarboxylase antizyme 1 OS=Mus musculus OX=10090 GN=Oaz1 PE=1 SV=3
4	O08608	7.15e-60	188	189	0.430	0.519	OAZ2_MOUSE Ornithine decarboxylase antizyme 2 OS=Mus musculus OX=10090 GN=Oaz2 PE=1 SV=2
5	O95190	8.24e-60	188	189	0.430	0.519	OAZ2_HUMAN Ornithine decarboxylase antizyme 2 OS=Homo sapiens OX=9606 GN=OAZ2 PE=1 SV=1
6	H0Y7Y4	2.51e-27	105	203	0.254	0.286	H0Y7Y4_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
7	A0A0G2JH29	3.09e-27	104	190	0.254	0.305	A0A0G2JH29_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
8	Q9UMX2	8.02e-27	105	235	0.254	0.247	OAZ3_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
9	A8MW57	8.19e-27	105	235	0.254	0.247	A8MW57_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
10	A1BPI0	6.59e-26	102	243	0.254	0.239	OAZ3_RAT Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1
11	Q9R109	8.31e-26	102	243	0.237	0.222	OAZ3_MOUSE Ornithine decarboxylase antizyme 3 OS=Mus musculus OX=10090 GN=Oaz3 PE=1 SV=2
12	J3QLT2	9.03e-24	94.0	123	0.175	0.325	J3QLT2_HUMAN Ornithine decarboxylase antizyme 3 (Fragment) OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
13	P54361	1.78e-15	75.1	254	0.180	0.161	OAZ_DROME Ornithine decarboxylase antizyme OS=Drosophila melanogaster OX=7227 GN=Oda PE=2 SV=2
14	H6WZF2	2.6	31.6	543	0.057	0.024	TER_NICAL Terpineol synthase, chloroplastic OS=Nicotiana alata OX=4087 GN=TER PE=1 SV=1
15	H2ELN1	2.9	31.6	522	0.057	0.025	TER_NICLA Terpineol synthase, chloroplastic (Fragment) OS=Nicotiana langsdorffii OX=118700 GN=TER PE=1 SV=1
16	Q9R237	5.5	30.4	708	0.070	0.023	JIP1_RAT C-Jun-amino-terminal kinase-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mapk8ip1 PE=1 SV=2
17	Q9WVI9	6.4	30.4	707	0.070	0.023	JIP1_MOUSE C-Jun-amino-terminal kinase-interacting protein 1 OS=Mus musculus OX=10090 GN=Mapk8ip1 PE=1 SV=2
18	Q9V5M6	9.3	30.0	963	0.066	0.016	LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02100 ODC_AZ	8.3e-15	66.2	Ornithine decarboxylase antizyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000473381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234111	0.998	Ornithine decarboxylase
2	9606.ENSP00000337180	0.998	Antizyme inhibitor 1
3	9606.ENSP00000481029	0.966	26S proteasome regulatory subunit 6A
4	9606.ENSP00000216455	0.963	Proteasome subunit alpha type-3
5	9606.ENSP00000342676	0.961	Aurora kinase A-interacting protein
6	9606.ENSP00000290541	0.932	Proteasome subunit beta type-4
7	9606.ENSP00000313922	0.931	Ornithine decarboxylase antizyme 3
8	9606.ENSP00000270586	0.928	Proteasome subunit beta type-6
9	9606.ENSP00000463013	0.924	Ornithine decarboxylase antizyme 2
10	9606.ENSP00000264639	0.912	26S proteasome non-ATPase regulatory subunit 3
11	9606.ENSP00000262193	0.911	Proteasome subunit beta type-1
12	9606.ENSP00000157812	0.909	26S proteasome regulatory subunit 6B
13	9606.ENSP00000310572	0.909	26S proteasome regulatory subunit 8
14	9606.ENSP00000362334	0.909	Proteasome subunit beta type-2
15	9606.ENSP00000391211	0.908	26S proteasome regulatory subunit 7
16	9606.ENSP00000483688	0.908	Proteasome subunit beta type-3
17	9606.ENSP00000359910	0.907	Proteasome subunit alpha type-7
18	9606.ENSP00000216911	0.906	Aurora kinase A
19	9606.ENSP00000259457	0.906	Proteasome subunit beta type-7
20	9606.ENSP00000351314	0.906	Proteasome subunit beta type-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008073	1.000	ornithine decarboxylase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.988	regulation of metabolic process
GO:0006576	0.985	biogenic amine metabolic process
GO:0006595	0.984	polyamine metabolic process
GO:0042176	0.972	regulation of protein catabolic process
GO:0045732	0.963	positive regulation of protein catabolic process
GO:0009987	0.928	cellular process
GO:0044237	0.825	cellular metabolic process
GO:0009058	0.522	biosynthetic process
GO:0050794	0.516	regulation of cellular process
GO:0034641	0.500	cellular nitrogen compound metabolic process
GO:1901576	0.455	organic substance biosynthetic process
GO:0044271	0.415	cellular nitrogen compound biosynthetic process
GO:1901566	0.410	organonitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.851	membrane-bounded organelle
GO:0043231	0.737	intracellular membrane-bounded organelle
GO:0032991	0.515	protein-containing complex
GO:0005634	0.399	nucleus
GO:0031981	0.347	nuclear lumen
GO:0005654	0.329	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]