StarFunc result for job id P54577

User Input

>input (528 residues)
MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIA
DFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKG
TDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVD
AQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKED
VKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFA
AEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEP
EEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEE
LKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4R1	0.681	0.681	1.704E-95	528	1.000	1.000	A0A0S2Z4R1.pdb.gz	A0A0S2Z4R1_HUMAN Tyrosine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 GN=YARS PE=2 SV=1
2	AFDB:Q6TGS6	0.662	0.661	4.372E-87	529	0.818	0.817	Q6TGS6.pdb.gz	SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=yars1 PE=2 SV=2
3	AFDB:Q9VV60	0.663	0.667	1.363E-72	525	0.669	0.672	Q9VV60.pdb.gz	Q9VV60_DROME Tyrosine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=TyrRS PE=1 SV=1
4	AFDB:P36421	0.637	0.847	3.940E-45	394	0.386	0.518	P36421.pdb.gz	SYYC_YEAST Tyrosine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TYS1 PE=1 SV=3
5	AFDB:O14055	0.630	0.825	6.659E-45	401	0.373	0.491	O14055.pdb.gz	SYYC_SCHPO Tyrosine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tys1 PE=3 SV=1
6	PDB:2dlcX	0.598	0.919	2.813E-42	339	0.366	0.569	2dlcX.pdb.gz	Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.
7	AFDB:Q8IAR7	0.595	0.832	3.745E-28	373	0.205	0.290	Q8IAR7.pdb.gz	Q8IAR7_PLAF7 tyrosine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0807900 PE=1 SV=1
8	PDB:7rorB	0.591	0.848	4.957E-27	362	0.203	0.296	7rorB.pdb.gz	Reaction hijacking of tyrosine tRNA synthetase as a new whole-of-life-cycle antimalarial strategy.
9	AFDB:Q9SVN5	0.315	0.210	2.838E-22	797	0.292	0.193	Q9SVN5.pdb.gz	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
10	AFDB:Q57WH7	0.576	0.440	1.370E-21	697	0.174	0.132	Q57WH7.pdb.gz	Q57WH7_TRYB2 Tyrosyl-tRNA synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.380 PE=4 SV=1
11	AFDB:P31230	0.315	0.533	5.649E-21	310	0.167	0.284	P31230.pdb.gz	AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus OX=10090 GN=Aimp1 PE=1 SV=2
12	AFDB:Q4G079	0.310	0.517	7.740E-21	315	0.174	0.292	Q4G079.pdb.gz	Q4G079_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
13	PDB:2j5bA	0.527	0.843	2.516E-18	321	0.142	0.234	2j5bA.pdb.gz	Virus-Encoded Aminoacyl-tRNA Synthetases: Structural and Functional Characterization of Mimivirus Tyrrs and Metrs.
14	PDB:5ujjA	0.456	0.532	7.414E-13	446	0.125	0.148	5ujjA.pdb.gz	An alternative conformation of human TrpRS suggests a role of zinc in activating non-enzymatic function.
15	PDB:3kt8D	0.467	0.589	7.079E-12	410	0.095	0.122	3kt8D.pdb.gz	Crystal structures of Saccharomyces cerevisiae tryptophanyl-tRNA synthetase: new insights into the mechanism of tryptophan activation and implications for anti-fungal drug design
16	PDB:7eltA	0.424	0.651	2.260E-10	330	0.110	0.176	7eltA.pdb.gz	Investigate Natural Product Indolmycin and the Synthetically Improved Analogue Toward Antimycobacterial Agents.
17	PDB:5ekdA	0.350	0.531	2.510E-10	327	0.108	0.174	5ekdA.pdb.gz	Binding of Mg2+ATP Enhances Inhibition of Human Mitochondrial Tryptophanyl-tRNA Synthetase by Indolmycin
18	PDB:3ts1A	0.410	0.640	3.819E-10	317	0.108	0.180	3ts1A.pdb.gz	Structure of tyrosyl-tRNA synthetase refined at 2.3 A resolution. Interaction of the enzyme with the tyrosyl adenylate intermediate.
19	PDB:3i05B	0.404	0.618	7.555E-10	331	0.102	0.163	3i05B.pdb.gz
20	PDB:6hb5B	0.390	0.479	1.843E-9	417	0.087	0.110	6hb5B.pdb.gz	Comparative analysis of pyrimidine substituted aminoacyl-sulfamoyl nucleosides as potential inhibitors targeting class I aminoacyl-tRNA synthetases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4R1	0.0	1074	528	1.000	1.000	A0A0S2Z4R1_HUMAN Tyrosine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 GN=YARS PE=2 SV=1
2	P54577	0.0	1074	528	1.000	1.000	SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4
3	Q6TGS6	0.0	882	529	0.818	0.817	SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=yars1 PE=2 SV=2
4	Q9VV60	0.0	697	525	0.667	0.670	Q9VV60_DROME Tyrosine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=TyrRS PE=1 SV=1
5	P36421	4.99e-139	409	394	0.377	0.505	SYYC_YEAST Tyrosine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TYS1 PE=1 SV=3
6	O14055	1.78e-137	405	401	0.366	0.481	SYYC_SCHPO Tyrosine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tys1 PE=3 SV=1
7	P31230	2.57e-50	177	310	0.167	0.284	AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus OX=10090 GN=Aimp1 PE=1 SV=2
8	A0A8I6A263	3.11e-50	177	321	0.170	0.280	A0A8I6A263_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
9	Q4G079	3.17e-50	176	315	0.170	0.286	Q4G079_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
10	Q12904	4.60e-49	173	312	0.167	0.282	AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2
11	Q9SVN5	9.32e-43	165	797	0.174	0.115	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
12	Q8IAR7	9.15e-40	150	373	0.203	0.287	Q8IAR7_PLAF7 tyrosine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0807900 PE=1 SV=1
13	Q54DX3	1.89e-37	143	363	0.157	0.229	Q54DX3_DICDI Endothelial monocyte-activating polypeptide II pro-EMAP II family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291926 PE=4 SV=1
14	Q6FNN0	2.49e-36	140	376	0.140	0.197	Q6FNN0_CANGA Candida glabrata strain CBS138 chromosome J complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0J10406g PE=4 SV=1
15	Q93VB0	1.78e-34	135	389	0.144	0.195	Q93VB0_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g40660 PE=1 SV=1
16	Q9M1X8	2.05e-34	132	273	0.144	0.278	Q9M1X8_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=F24G16.250 PE=1 SV=1
17	P46672	3.26e-34	135	376	0.134	0.189	ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARC1 PE=1 SV=2
18	Q9P6K7	8.01e-31	127	450	0.129	0.151	ARC1_SCHPO tRNA-aminoacylation cofactor arc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC30C2.04 PE=3 SV=1
19	Q57XN4	2.34e-25	110	425	0.114	0.141	Q57XN4_TRYB2 Tyrosyl-tRNA synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.390 PE=4 SV=1
20	Q57UK5	5.75e-25	105	223	0.121	0.287	Q57UK5_TRYB2 Tyrosyl/methionyl-tRNA synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.5H5.270 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00579 tRNA-synt_1b	9e-72	253.5	tRNA synthetases class I (W and Y)
2	PF01588 tRNA_bind	4.8e-30	114.9	Putative tRNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362576

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.998	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000307567	0.995	Glutamine--tRNA ligase
3	9606.ENSP00000261772	0.991	Alanine--tRNA ligase, cytoplasmic
4	9606.ENSP00000262027	0.989	Methionine--tRNA ligase, cytoplasmic
5	9606.ENSP00000373918	0.989	Glycine--tRNA ligase
6	9606.ENSP00000347495	0.987	Tryptophan--tRNA ligase, cytoplasmic
7	9606.ENSP00000377954	0.986	Leucine--tRNA ligase, cytoplasmic
8	9606.ENSP00000325448	0.985	Lysine--tRNA ligase
9	9606.ENSP00000364794	0.981	Isoleucine--tRNA ligase, cytoplasmic
10	9606.ENSP00000408576	0.981	Probable leucine--tRNA ligase, mitochondrial
11	9606.ENSP00000369897	0.979	Cysteine--tRNA ligase, cytoplasmic
12	9606.ENSP00000234677	0.977	Serine--tRNA ligase, cytoplasmic
13	9606.ENSP00000257347	0.972	Probable cysteine--tRNA ligase, mitochondrial
14	9606.ENSP00000425634	0.972	Histidine--tRNA ligase, cytoplasmic
15	9606.ENSP00000320658	0.971	Tyrosine--tRNA ligase, mitochondrial
16	9606.ENSP00000320309	0.968	phenylalanyl-tRNA synthetase alpha subunit
17	9606.ENSP00000235521	0.967	Tryptophan--tRNA ligase, mitochondrial
18	9606.ENSP00000360327	0.966	Probable proline--tRNA ligase, mitochondrial
19	9606.ENSP00000472847	0.966	Serine--tRNA ligase, mitochondrial
20	9606.ENSP00000256854	0.963	Asparagine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004831	0.998	tyrosine-tRNA ligase activity
GO:0003723	0.997	RNA binding
GO:0005102	0.981	signaling receptor binding
GO:0042379	0.834	chemokine receptor binding
GO:0042802	0.449	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006412	0.987	translation
GO:0044281	0.985	small molecule metabolic process
GO:0016070	0.977	RNA metabolic process
GO:0043038	0.971	amino acid activation
GO:0006399	0.958	tRNA metabolic process
GO:0006418	0.936	tRNA aminoacylation for protein translation
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016604	0.982	nuclear body
GO:0005576	0.953	extracellular region
GO:0005615	0.907	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10220	0.998	ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr)
EC:6.1.1.1	0.998	tyrosine--tRNA ligase.

[back to server]