StarFunc result for job id P54578

User Input

>input (494 residues)
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCT
PELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY
GPRRVEIMEEESEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54578	1.000	1.000	1.186E-103	494	1.000	1.000	P54578.pdb.gz	UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3
2	PDB:7w3ax	0.748	0.748	2.117E-83	494	1.000	1.000	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
3	AFDB:Q9VKZ8	0.742	0.771	7.164E-71	475	0.545	0.566	Q9VKZ8.pdb.gz	Q9VKZ8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp14 PE=1 SV=1
4	AFDB:Q949Y0	0.674	0.690	5.292E-59	482	0.427	0.438	Q949Y0.pdb.gz	UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=UBP6 PE=1 SV=1
5	PDB:5gjqx	0.685	0.947	1.269E-58	355	0.704	0.980	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
6	AFDB:Q92353	0.649	0.685	2.265E-51	468	0.387	0.408	Q92353.pdb.gz	UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp6 PE=1 SV=2
7	AFDB:P43593	0.618	0.613	5.094E-46	499	0.318	0.315	P43593.pdb.gz	UBP6_YEAST Ubiquitin carboxyl-terminal hydrolase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP6 PE=1 SV=1
8	AFDB:Q583H3	0.635	0.673	1.048E-44	465	0.312	0.331	Q583H3.pdb.gz	Q583H3_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.180 PE=3 SV=1
9	PDB:7qo48	0.628	0.822	3.166E-33	372	0.253	0.336	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
10	PDB:5mpc8	0.592	0.731	4.975E-30	395	0.243	0.304	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
11	AFDB:Q8BY87	0.526	0.201	1.705E-26	1376	0.202	0.073	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
12	AFDB:Q6P8X6	0.548	0.685	1.121E-25	390	0.202	0.256	Q6P8X6.pdb.gz	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
13	AFDB:Q9VCT9	0.547	0.632	1.121E-25	424	0.170	0.198	Q9VCT9.pdb.gz	Q9VCT9_DROME RE52890p OS=Drosophila melanogaster OX=7227 GN=Usp12-46 PE=2 SV=1
14	AFDB:Q9LEW0	0.532	0.474	9.252E-25	557	0.150	0.133	Q9LEW0.pdb.gz	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
15	PDB:5cvnB	0.532	0.803	4.071E-23	321	0.164	0.252	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
16	PDB:5k16B	0.510	0.751	9.049E-23	328	0.160	0.241	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
17	PDB:3mhsA	0.508	0.549	2.209E-21	455	0.160	0.174	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
18	PDB:7ay1D	0.522	0.744	4.910E-21	341	0.164	0.238	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
19	PDB:7yxxA	0.511	0.153	1.198E-19	1754	0.156	0.044	7yxxA.pdb.gz
20	PDB:8a9kD	0.471	0.792	4.989E-19	285	0.154	0.267	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJA2	0.0	909	448	0.907	1.000	A6NJA2_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=2
2	P54578	0.0	1026	494	1.000	1.000	UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3
3	Q0IIF7	0.0	1009	494	0.980	0.980	UBP14_BOVIN Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus OX=9913 GN=USP14 PE=2 SV=3
4	Q9JMA1	0.0	996	493	0.968	0.970	UBP14_MOUSE Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus OX=10090 GN=Usp14 PE=1 SV=3
5	Q9VKZ8	0.0	557	475	0.545	0.566	Q9VKZ8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp14 PE=1 SV=1
6	Q949Y0	5.68e-136	403	482	0.439	0.450	UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=UBP6 PE=1 SV=1
7	Q92353	2.22e-101	314	468	0.379	0.400	UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp6 PE=1 SV=2
8	P43593	4.49e-71	236	499	0.330	0.327	UBP6_YEAST Ubiquitin carboxyl-terminal hydrolase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP6 PE=1 SV=1
9	Q583H3	9.22e-69	229	465	0.320	0.340	Q583H3_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.180 PE=3 SV=1
10	A6NNY8	2.80e-17	86.3	438	0.211	0.237	UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens OX=9606 GN=USP27X PE=1 SV=3
11	Q8CEG8	4.61e-17	85.5	438	0.204	0.231	UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus OX=10090 GN=Usp27x PE=1 SV=2
12	Q70EK9	2.72e-16	84.3	711	0.219	0.152	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
13	Q9UPT9	3.26e-15	80.5	525	0.211	0.198	UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens OX=9606 GN=USP22 PE=1 SV=2
14	Q5DU02	4.99e-15	79.7	525	0.209	0.196	UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus OX=10090 GN=Usp22 PE=2 SV=2
15	H1UUC2	3.14e-14	76.3	367	0.198	0.267	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
16	O74442	1.13e-13	75.1	457	0.211	0.228	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
17	Q8MQX4	3.59e-13	74.3	896	0.198	0.109	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
18	Q9VDD8	4.58e-13	74.3	896	0.198	0.109	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
19	X2JLM6	8.44e-12	69.7	565	0.194	0.170	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
20	Q8IQ27	2.64e-11	68.6	938	0.194	0.102	UBP2_DROME Ubiquitin carboxyl-terminal hydrolase Usp2 OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15499 Peptidase_C98	45	15.0	Ubiquitin-specific peptidase-like, SUMO isopeptidase
2	PF00240 ubiquitin	1.2	20.2	Ubiquitin family
3	PF00443 UCH	2.6e-53	192.9	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	5.7e-07	41.1	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261601

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000044462	0.999	Proteasome subunit alpha type-4
2	9606.ENSP00000157812	0.999	26S proteasome regulatory subunit 6B
3	9606.ENSP00000215071	0.999	26S proteasome non-ATPase regulatory subunit 8
4	9606.ENSP00000219313	0.999	26S proteasome non-ATPase regulatory subunit 7
5	9606.ENSP00000261303	0.999	26S proteasome regulatory subunit 4
6	9606.ENSP00000261479	0.999	Proteasome subunit alpha type-6
7	9606.ENSP00000261712	0.999	26S proteasome non-ATPase regulatory subunit 11
8	9606.ENSP00000264639	0.999	26S proteasome non-ATPase regulatory subunit 3
9	9606.ENSP00000309474	0.999	26S proteasome non-ATPase regulatory subunit 1
10	9606.ENSP00000310129	0.999	26S proteasome non-ATPase regulatory subunit 2
11	9606.ENSP00000310572	0.999	26S proteasome regulatory subunit 8
12	9606.ENSP00000348442	0.999	26S proteasome non-ATPase regulatory subunit 12
13	9606.ENSP00000357879	0.999	26S proteasome non-ATPase regulatory subunit 4
14	9606.ENSP00000386541	0.999	26S proteasome non-ATPase regulatory subunit 14
15	9606.ENSP00000391211	0.999	26S proteasome regulatory subunit 7
16	9606.ENSP00000396937	0.999	Proteasome 26S subunit, non-ATPase 13
17	9606.ENSP00000401802	0.999	26S proteasome regulatory subunit 10B
18	9606.ENSP00000418695	0.999	Proteasome 26S subunit, non-ATPase 6
19	9606.ENSP00000481029	0.999	26S proteasome regulatory subunit 6A
20	9606.ENSP00000216455	0.998	Proteasome subunit alpha type-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004843	0.999	cysteine-type deubiquitinase activity
GO:0070628	0.997	proteasome binding
GO:0004197	0.546	cysteine-type endopeptidase activity
GO:0030414	0.373	peptidase inhibitor activity
GO:0061135	0.369	endopeptidase regulator activity
GO:0004866	0.361	endopeptidase inhibitor activity
GO:0061578	0.360	K63-linked deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0019538	0.987	protein metabolic process
GO:0009987	0.961	cellular process
GO:0070647	0.958	protein modification by small protein conjugation or removal
GO:0050789	0.956	regulation of biological process
GO:0019222	0.940	regulation of metabolic process
GO:0006508	0.940	proteolysis
GO:0070646	0.905	protein modification by small protein removal
GO:0050794	0.894	regulation of cellular process
GO:0016579	0.886	protein deubiquitination
GO:0060255	0.799	regulation of macromolecule metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0051171	0.772	regulation of nitrogen compound metabolic process
GO:0007154	0.729	cell communication
GO:0023052	0.719	signaling
GO:0007267	0.663	cell-cell signaling
GO:0048519	0.610	negative regulation of biological process
GO:0051246	0.591	regulation of protein metabolic process
GO:0009894	0.511	regulation of catabolic process
GO:0031323	0.497	regulation of cellular metabolic process
GO:0030162	0.484	regulation of proteolysis
GO:0044237	0.479	cellular metabolic process
GO:0050896	0.465	response to stimulus
GO:0009892	0.452	negative regulation of metabolic process
GO:0099536	0.405	synaptic signaling
GO:0010605	0.405	negative regulation of macromolecule metabolic process
GO:0048583	0.404	regulation of response to stimulus
GO:0048523	0.400	negative regulation of cellular process
GO:1903050	0.392	regulation of proteolysis involved in protein catabolic process
GO:0048518	0.370	positive regulation of biological process
GO:0051172	0.349	negative regulation of nitrogen compound metabolic process
GO:0051716	0.345	cellular response to stimulus
GO:0010468	0.335	regulation of gene expression
GO:0019219	0.334	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.308	positive regulation of metabolic process
GO:0010604	0.300	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005829	0.984	cytosol
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0016020	0.972	membrane
GO:0005654	0.958	nucleoplasm
GO:0071944	0.921	cell periphery
GO:0005886	0.914	plasma membrane
GO:0032991	0.752	protein-containing complex
GO:0031982	0.562	vesicle
GO:0043230	0.437	extracellular organelle
GO:1903561	0.431	extracellular vesicle
GO:0070062	0.350	extracellular exosome
GO:0030054	0.305	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.546	Cysteine endopeptidases.

[back to server]