StarFunc result for job id P54646

User Input

>input (552 residues)
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54646	1.000	1.000	2.321E-96	552	1.000	1.000	P54646.pdb.gz	AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2
2	AFDB:A5WUM0	0.860	0.829	1.123E-76	573	0.739	0.712	A5WUM0.pdb.gz	A5WUM0_DANRE Acetyl-CoA carboxylase kinase OS=Danio rerio OX=7955 GN=cb116 PE=1 SV=1
3	AFDB:W5PHS8	0.846	0.815	2.208E-76	574	0.759	0.730	W5PHS8.pdb.gz	W5PHS8_SHEEP Acetyl-CoA carboxylase kinase OS=Ovis aries OX=9940 GN=PRKAA1 PE=3 SV=1
4	AFDB:A0A060VX13	0.859	0.849	4.123E-76	559	0.743	0.733	A0A060VX13.pdb.gz	A0A060VX13_ONCMY Acetyl-CoA carboxylase kinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00072767001 PE=3 SV=1
5	PDB:7myjC	0.769	0.906	1.669E-70	465	0.833	0.989	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
6	PDB:6b1uA	0.750	0.929	1.115E-67	442	0.793	0.991	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
7	AFDB:A0A060YAF5	0.808	0.781	1.772E-67	573	0.699	0.674	A0A060YAF5.pdb.gz	A0A060YAF5_ONCMY Acetyl-CoA carboxylase kinase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00033152001 PE=3 SV=1
8	AFDB:O18645	0.821	0.780	1.866E-67	582	0.636	0.603	O18645.pdb.gz	O18645_DROME AMP-activated protein kinase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=1 SV=1
9	AFDB:Q95ZQ4	0.805	0.713	1.314E-64	626	0.589	0.519	Q95ZQ4.pdb.gz	AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans OX=6239 GN=aak-2 PE=1 SV=2
10	PDB:4zhxA	0.708	0.947	1.116E-63	409	0.737	0.995	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
11	PDB:4rerA	0.769	0.917	3.554E-60	459	0.690	0.830	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
12	AFDB:P45894	0.653	0.614	5.224E-54	589	0.451	0.423	P45894.pdb.gz	AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans OX=6239 GN=aak-1 PE=2 SV=2
13	PDB:5ufuA	0.652	0.972	1.020E-52	369	0.580	0.867	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:4rewA	0.707	0.942	1.394E-52	411	0.627	0.842	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	AFDB:B9DFC1	0.635	0.683	3.106E-50	512	0.420	0.453	B9DFC1.pdb.gz	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
16	AFDB:P92958	0.640	0.690	1.083E-49	512	0.411	0.443	P92958.pdb.gz	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1
17	PDB:5u6yA	0.433	0.517	3.431E-25	459	0.210	0.253	5u6yA.pdb.gz
18	PDB:4cztD	0.433	0.767	4.011E-25	302	0.219	0.401	4cztD.pdb.gz
19	PDB:4d28C	0.427	0.822	1.814E-24	279	0.208	0.412	4d28C.pdb.gz
20	PDB:6byrA	0.444	0.601	5.341E-23	405	0.161	0.220	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VX13	0.0	846	559	0.745	0.735	A0A060VX13_ONCMY Acetyl-CoA carboxylase kinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00072767001 PE=3 SV=1
2	A0A060YAF5	0.0	763	573	0.690	0.665	A0A060YAF5_ONCMY Acetyl-CoA carboxylase kinase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00033152001 PE=3 SV=1
3	A5WUM0	0.0	808	573	0.746	0.719	A5WUM0_DANRE Acetyl-CoA carboxylase kinase OS=Danio rerio OX=7955 GN=cb116 PE=1 SV=1
4	O18645	0.0	687	582	0.645	0.612	O18645_DROME AMP-activated protein kinase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=1 SV=1
5	P54645	0.0	870	559	0.759	0.750	AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Prkaa1 PE=1 SV=2
6	P54646	0.0	1153	552	1.000	1.000	AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2
7	Q09137	0.0	1136	552	0.982	0.982	AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Prkaa2 PE=1 SV=1
8	Q13131	0.0	873	559	0.761	0.751	AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4
9	Q2LAI0	0.0	1078	552	0.940	0.940	Q2LAI0_CHICK 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Gallus gallus OX=9031 GN=PRKAA2 PE=2 SV=1
10	Q2PUH1	0.0	851	560	0.750	0.739	Q2PUH1_CHICK Acetyl-CoA carboxylase kinase OS=Gallus gallus OX=9031 GN=PRKAA1 PE=1 SV=1
11	Q5EG47	0.0	868	559	0.757	0.748	AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus OX=10090 GN=Prkaa1 PE=1 SV=2
12	Q5U118	0.0	686	582	0.643	0.610	Q5U118_DROME LP06206p OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=2 SV=1
13	Q8BRK8	0.0	1127	552	0.978	0.978	AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus OX=10090 GN=Prkaa2 PE=1 SV=3
14	Q95ZQ4	0.0	635	626	0.601	0.530	AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans OX=6239 GN=aak-2 PE=1 SV=2
15	W5PHS8	0.0	864	574	0.759	0.730	W5PHS8_SHEEP Acetyl-CoA carboxylase kinase OS=Ovis aries OX=9940 GN=PRKAA1 PE=3 SV=1
16	W5PHS9	0.0	874	559	0.759	0.750	W5PHS9_SHEEP Acetyl-CoA carboxylase kinase OS=Ovis aries OX=9940 GN=PRKAA1 PE=3 SV=1
17	A0A060Y6Z6	8.44e-177	503	333	0.440	0.730	A0A060Y6Z6_ONCMY Protein kinase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00048326001 PE=4 SV=1
18	A0A060YH61	1.79e-176	501	291	0.428	0.811	A0A060YH61_ONCMY Protein kinase domain-containing protein (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008872001 PE=4 SV=1
19	Q7KK41	5.24e-161	467	437	0.457	0.577	Q7KK41_DROME SNF1A OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=2 SV=1
20	P45894	8.50e-156	459	589	0.440	0.413	AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans OX=6239 GN=aak-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.022	25.5	ABC1 atypical kinase-like domain
2	PF16579 AdenylateSensor	3.8e-11	54.8	Adenylate sensor of SNF1-like protein kinase
3	PF01636 APH	1.8e+02	13.4	Phosphotransferase enzyme family
4	PF06293 Kdo	23	15.8	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.017	26.1	Kinase-like
6	PF00069 Pkinase	3.4e-69	244.7	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	6.1e-38	142.2	Protein tyrosine and serine/threonine kinase
8	PF01163 RIO1	4.1	18.5	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360290

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229328	0.999	5'-AMP-activated protein kinase subunit beta-1
2	9606.ENSP00000254101	0.999	5'-AMP-activated protein kinase subunit beta-2
3	9606.ENSP00000287878	0.999	5'-AMP-activated protein kinase subunit gamma-2
4	9606.ENSP00000323867	0.999	5'-AMP-activated protein kinase subunit gamma-1
5	9606.ENSP00000397133	0.984	5'-AMP-activated protein kinase subunit gamma-3
6	9606.ENSP00000483300	0.983	Acetyl-CoA carboxylase 1
7	9606.ENSP00000324856	0.980	Serine/threonine-protein kinase STK11
8	9606.ENSP00000354558	0.979	Serine/threonine-protein kinase mTOR
9	9606.ENSP00000312741	0.975	Calcium/calmodulin-dependent protein kinase kinase 2
10	9606.ENSP00000307272	0.974	Regulatory-associated protein of mTOR
11	9606.ENSP00000264867	0.969	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
12	9606.ENSP00000262187	0.957	GTP-binding protein Rheb
13	9606.ENSP00000219476	0.954	Tuberin
14	9606.ENSP00000262850	0.950	Ras-related GTP-binding protein B
15	9606.ENSP00000369899	0.949	Ras-related GTP-binding protein A
16	9606.ENSP00000312652	0.948	Leptin
17	9606.ENSP00000355231	0.948	Beclin-1
18	9606.ENSP00000456405	0.944	Target of rapamycin complex subunit LST8
19	9606.ENSP00000298552	0.943	Hamartin
20	9606.ENSP00000262039	0.942	Phosphatidylinositol 3-kinase catalytic subunit type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004679	0.992	AMP-activated protein kinase activity
GO:0019899	0.532	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.990	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0008152	0.958	metabolic process
GO:0051716	0.932	cellular response to stimulus
GO:0044238	0.899	primary metabolic process
GO:0044237	0.899	cellular metabolic process
GO:0071704	0.898	organic substance metabolic process
GO:0048518	0.841	positive regulation of biological process
GO:0031667	0.795	response to nutrient levels
GO:0019222	0.791	regulation of metabolic process
GO:0006807	0.762	nitrogen compound metabolic process
GO:1901564	0.750	organonitrogen compound metabolic process
GO:0043170	0.749	macromolecule metabolic process
GO:0007154	0.744	cell communication
GO:0031323	0.738	regulation of cellular metabolic process
GO:0006796	0.735	phosphate-containing compound metabolic process
GO:0016310	0.699	phosphorylation
GO:0048522	0.696	positive regulation of cellular process
GO:0080090	0.690	regulation of primary metabolic process
GO:0019538	0.685	protein metabolic process
GO:0036211	0.681	protein modification process
GO:0060255	0.679	regulation of macromolecule metabolic process
GO:0042221	0.624	response to chemical
GO:0006468	0.503	protein phosphorylation
GO:0048519	0.487	negative regulation of biological process
GO:0051171	0.473	regulation of nitrogen compound metabolic process
GO:0006950	0.472	response to stress
GO:0009893	0.465	positive regulation of metabolic process
GO:0048523	0.449	negative regulation of cellular process
GO:0023052	0.434	signaling
GO:0031325	0.430	positive regulation of cellular metabolic process
GO:0010604	0.424	positive regulation of macromolecule metabolic process
GO:0023051	0.420	regulation of signaling
GO:0010468	0.412	regulation of gene expression
GO:0009966	0.412	regulation of signal transduction
GO:0007165	0.412	signal transduction
GO:0071496	0.387	cellular response to external stimulus
GO:0033554	0.367	cellular response to stress
GO:0031329	0.346	regulation of cellular catabolic process
GO:0051246	0.345	regulation of protein metabolic process
GO:0051173	0.327	positive regulation of nitrogen compound metabolic process
GO:0009889	0.323	regulation of biosynthetic process
GO:0070887	0.323	cellular response to chemical stimulus
GO:0071310	0.306	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.991	cytosol
GO:0070013	0.979	intracellular organelle lumen
GO:0032991	0.978	protein-containing complex
GO:0140535	0.972	intracellular protein-containing complex
GO:0016020	0.970	membrane
GO:1990234	0.970	transferase complex
GO:0005654	0.966	nucleoplasm
GO:0061695	0.945	transferase complex, transferring phosphorus-containing groups
GO:0071944	0.938	cell periphery
GO:0005886	0.926	plasma membrane
GO:1902911	0.919	protein kinase complex
GO:0012505	0.910	endomembrane system
GO:0031588	0.906	nucleotide-activated protein kinase complex
GO:0036477	0.734	somatodendritic compartment
GO:0044297	0.691	cell body
GO:0120025	0.485	plasma membrane bounded cell projection
GO:0043005	0.443	neuron projection
GO:0043232	0.397	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.11	0.992	cAMP-dependent protein kinase.

[back to server]