StarFunc result for job id P54652

User Input

>input (639 residues)
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08108	0.952	0.934	0.000	651	0.851	0.836	P08108.pdb.gz	HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss OX=8022 GN=hsc71 PE=2 SV=2
2	AFDB:P11147	0.955	0.937	0.000	651	0.829	0.814	P11147.pdb.gz	HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster OX=7227 GN=Hsc70-4 PE=1 SV=3
3	AFDB:P16627	0.975	0.972	0.000	641	0.826	0.824	P16627.pdb.gz	HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus OX=10090 GN=Hspa1l PE=1 SV=4
4	AFDB:P54652	1.000	1.000	0.000	639	1.000	1.000	P54652.pdb.gz	HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1
5	AFDB:Q59EJ3	0.956	0.862	0.000	709	0.839	0.756	Q59EJ3.pdb.gz	Q59EJ3_HUMAN Heat shock 70kDa protein 1A variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:Q5KT34	0.962	0.955	0.000	644	0.814	0.807	Q5KT34.pdb.gz	Q5KT34_ONCMY Heat shock 70kDa protein OS=Oncorhynchus mykiss OX=8022 GN=HSP70b PE=2 SV=1
7	AFDB:Q9IAC1	0.959	0.932	5.428E-104	658	0.823	0.799	Q9IAC1.pdb.gz
8	AFDB:P27541	0.957	0.949	1.087E-103	644	0.831	0.825	P27541.pdb.gz	HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi OX=6279 GN=HSP70 PE=3 SV=1
9	AFDB:P17066	0.969	0.963	2.219E-103	643	0.789	0.784	P17066.pdb.gz	HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2
10	AFDB:O59855	0.962	0.950	4.665E-101	647	0.754	0.745	O59855.pdb.gz	HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssa2 PE=1 SV=3
11	PDB:6asyA	0.879	0.925	1.030E-79	606	0.606	0.639	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
12	PDB:7kw7C	0.567	0.701	2.209E-74	511	0.692	0.865	7kw7C.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:5fpnA	0.537	0.870	1.366E-62	379	0.593	1.000	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
14	PDB:7krwA	0.655	0.686	1.324E-59	608	0.465	0.488	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
15	PDB:2qxlB	0.814	0.832	8.797E-50	625	0.260	0.266	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
16	PDB:3c7nA	0.809	0.797	1.419E-46	649	0.261	0.257	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
17	PDB:6sr6C	0.550	0.663	1.687E-43	524	0.230	0.281	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
18	PDB:7x3kB	0.558	0.694	4.395E-42	506	0.239	0.302	7x3kB.pdb.gz
19	PDB:6w6eI	0.502	0.867	4.007E-38	357	0.274	0.490	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	PDB:1jcfA	0.417	0.754	4.797E-16	336	0.135	0.256	1jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PFJ6	1132	638	0.847	0.848	A0A1D5PFJ6_CHICK Heat shock 70kDa protein 8 OS=Gallus gallus OX=9031 GN=HSPA8 PE=1 SV=2
2	A0A1D8PG96	769	687	0.595	0.553	A0A1D8PG96_CANAL Endoplasmic reticulum chaperone BiP OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KAR2 PE=3 SV=1
3	A0A384P5G6	586	679	0.490	0.461	A0A384P5G6_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
4	A0A509AJG0	769	651	0.587	0.576	BIP_PLABA Endoplasmic reticulum chaperone BIP OS=Plasmodium berghei (strain Anka) OX=5823 GN=BIP PE=1 SV=1
5	A0PA16	1132	646	0.847	0.837	A0PA16_COTJA Heat shock protein 70kDa OS=Coturnix japonica OX=93934 GN=HSPA8 PE=2 SV=1
6	A0QQC8	536	622	0.454	0.466	DNAK_MYCS2 Chaperone protein DnaK OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=dnaK PE=1 SV=1
7	A1A766	534	638	0.452	0.453	DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC OX=405955 GN=dnaK PE=3 SV=1
8	A5I640	543	623	0.473	0.485	DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=dnaK PE=3 SV=1
9	A8WFS0	1099	643	0.828	0.823	A8WFS0_DANRE Heat shock cognate 70-kd protein, like OS=Danio rerio OX=7955 GN=LOC560210 PE=2 SV=1
10	B0UXS6	1105	643	0.833	0.827	B0UXS6_DANRE Heat shock 70 kDa protein isoform X2 OS=Danio rerio OX=7955 GN=zgc:174006 PE=2 SV=1
11	B3VHV2	1182	634	0.914	0.921	B3VHV2_CHICK Heat shock protein 70 OS=Gallus gallus OX=9031 GN=HSP70 PE=2 SV=1
12	B5X397	808	657	0.618	0.601	B5X397_SALSA 78 kDa glucose-regulated protein OS=Salmo salar OX=8030 GN=GRP78 PE=2 SV=1
13	B6EAX2	1188	634	0.917	0.924	B6EAX2_CHICK Heat shock protein 70 OS=Gallus gallus OX=9031 GN=HSP70 PE=2 SV=1
14	B9RYP6	850	664	0.649	0.625	B9RYP6_RICCO Heat shock protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1312280 PE=3 SV=1
15	C8Z3H3	922	634	0.703	0.708	C8Z3H3_YEAS8 Ssa1p OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=EC1118_1A20_0804g PE=1 SV=1
16	D6RCD7	581	665	0.480	0.462	D6RCD7_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2
17	G3I8R9	807	654	0.624	0.610	BIP_CRIGR Endoplasmic reticulum chaperone BiP OS=Cricetulus griseus OX=10029 GN=HSPA5 PE=1 SV=1
18	G4NAY4	679	614	0.551	0.573	SSB1_MAGO7 Heat shock protein SSB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=SSB1 PE=1 SV=1
19	G8BEU5	779	684	0.590	0.551	G8BEU5_CANPC Endoplasmic reticulum chaperone BiP OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_213780 PE=3 SV=1
20	J9VZ70	951	643	0.715	0.711	HSP71_CRYNH Transcriptional coregulator SSA1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=SSA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01869 BcrAD_BadFG	35	15.4	BadF/BadG/BcrA/BcrD ATPase family
2	PF10534 CRIC_ras_sig	5.1e+02	12.2	Connector enhancer of kinase suppressor of ras
3	PF08841 DDR	2.6e+02	12.1	Diol dehydratase reactivase ATPase-like domain
4	PF07318 DUF1464	2.3e+02	12.3	Protein of unknown function (DUF1464)
5	PF02782 FGGY_C	0.36	22.1	FGGY family of carbohydrate kinases, C-terminal domain
6	PF14450 FtsA	2.6	19.9	Cell division protein FtsA
7	PF00012 HSP70	6.1e-258	868.6	Hsp70 protein
8	PF01968 Hydantoinase_A	2.3e+02	12.4	Hydantoinase/oxoprolinase
9	PF06723 MreB_Mbl	6.2e-14	63.2	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010382001.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353162.1	0.928	DnaJ heat shock protein family (Hsp40) member A2
2	61622.XP_010359868.1	0.918	DnaJ heat shock protein family (Hsp40) member B1
3	61622.XP_010376956.1	0.917	DnaJ heat shock protein family (Hsp40) member A4
4	61622.XP_010375189.1	0.909	Stress induced phosphoprotein 1
5	61622.XP_010352219.1	0.907	DnaJ heat shock protein family (Hsp40) member A3
6	61622.XP_010364738.1	0.906	Cation channel sperm-associated protein 1
7	61622.XP_010373626.1	0.904	cyclin-G-associated kinase isoform X1
8	61622.XP_010376844.1	0.897	DnaJ heat shock protein family (Hsp40) member A1
9	61622.XP_010374290.1	0.893	BCL2 associated athanogene 3
10	61622.XP_010378960.1	0.887	DnaJ heat shock protein family (Hsp40) member B4
11	61622.XP_010384116.1	0.887	DnaJ heat shock protein family (Hsp40) member B5
12	61622.XP_010356898.1	0.877	Cation channel sperm associated auxiliary subunit beta
13	61622.XP_010365135.1	0.872	DnaJ heat shock protein family (Hsp40) member B13
14	61622.XP_010365374.1	0.871	Heat shock protein family H (Hsp110) member 1
15	61622.XP_010381192.1	0.867	Toll like receptor 2
16	61622.XP_010375932.1	0.866	DnaJ heat shock protein family (Hsp40) member C2
17	61622.XP_010386232.1	0.864	BCL2 associated athanogene 2
18	61622.XP_010359870.1	0.853	dnaJ homolog subfamily B member 1-like
19	61622.XP_010384136.1	0.848	BCL2 associated athanogene 1
20	61622.XP_010365631.1	0.840	Cation channel sperm-associated protein subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.745	heterocyclic compound binding
GO:0097159	0.743	organic cyclic compound binding
GO:0003824	0.649	catalytic activity
GO:0051082	0.579	unfolded protein binding
GO:0097367	0.447	carbohydrate derivative binding
GO:1901265	0.301	nucleoside phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0050896	0.933	response to stimulus
GO:0006950	0.874	response to stress
GO:0009408	0.596	response to heat
GO:0065007	0.550	biological regulation
GO:0050789	0.521	regulation of biological process
GO:0050794	0.499	regulation of cellular process
GO:0008152	0.440	metabolic process
GO:0071704	0.407	organic substance metabolic process
GO:0044238	0.339	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.997	nucleus
GO:0005829	0.989	cytosol
GO:0032991	0.981	protein-containing complex
GO:0016020	0.981	membrane
GO:0070013	0.945	intracellular organelle lumen
GO:0005576	0.709	extracellular region
GO:0005615	0.700	extracellular space
GO:0043230	0.684	extracellular organelle
GO:0031981	0.554	nuclear lumen
GO:0070062	0.459	extracellular exosome
GO:0005886	0.360	plasma membrane
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]