StarFunc result for job id P54687

User Input

>input (386 residues)
MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTV
EWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRM
YRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQ
WGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPK
LASRILSKLTDIQYGREESDWTIVLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54687	1.000	1.000	3.050E-88	386	1.000	1.000	P54687.pdb.gz	BCAT1_HUMAN Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3
2	PDB:2abjA	0.947	0.999	6.593E-81	366	0.938	0.989	2abjA.pdb.gz	The design and synthesis of human branched-chain amino acid aminotransferase inhibitors for treatment of neurodegenerative diseases.
3	AFDB:P24288	0.944	0.944	2.247E-79	386	0.850	0.850	P24288.pdb.gz	BCAT1_MOUSE Branched-chain-amino-acid aminotransferase, cytosolic OS=Mus musculus OX=10090 GN=Bcat1 PE=1 SV=2
4	AFDB:P54690	0.945	0.888	3.914E-76	411	0.764	0.718	P54690.pdb.gz	BCAT1_RAT Branched-chain-amino-acid aminotransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Bcat1 PE=1 SV=1
5	AFDB:O35854	0.930	0.914	1.483E-65	393	0.583	0.573	O35854.pdb.gz	BCAT2_RAT Branched-chain-amino-acid aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bcat2 PE=1 SV=1
6	AFDB:M0QXF9	0.907	0.788	1.262E-62	445	0.552	0.479	M0QXF9.pdb.gz	M0QXF9_HUMAN Branched-chain-amino-acid aminotransferase (Fragment) OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=1
7	PDB:1ekfA	0.920	0.973	9.470E-60	365	0.552	0.584	1ekfA.pdb.gz	The structure of human mitochondrial branched-chain aminotransferase.
8	AFDB:P54688	0.922	0.858	3.861E-58	415	0.505	0.470	P54688.pdb.gz	BCAT_CAEEL Branched-chain-amino-acid aminotransferase, cytosolic OS=Caenorhabditis elegans OX=6239 GN=bcat-1 PE=2 SV=2
9	AFDB:Q9VYD5	0.923	0.805	2.108E-56	443	0.497	0.433	Q9VYD5.pdb.gz	Q9VYD5_DROME Branched-chain-amino-acid aminotransferase OS=Drosophila melanogaster OX=7227 GN=Bcat PE=1 SV=2
10	AFDB:P47176	0.921	0.945	1.331E-53	376	0.446	0.457	P47176.pdb.gz	BCA2_YEAST Branched-chain-amino-acid aminotransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT2 PE=1 SV=1
11	AFDB:O14370	0.922	0.835	1.013E-52	427	0.443	0.400	O14370.pdb.gz	BCA1_SCHPO Branched-chain-amino-acid aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eca39 PE=1 SV=3
12	AFDB:P38891	0.909	0.893	2.633E-52	393	0.435	0.427	P38891.pdb.gz	BCA1_YEAST Branched-chain-amino-acid aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT1 PE=1 SV=1
13	PDB:3dtfA	0.860	0.912	1.741E-40	363	0.347	0.369	3dtfA.pdb.gz	Structural analysis of mycobacterial branched-chain aminotransferase: implications for inhibitor design.
14	PDB:3ht5A	0.819	0.940	2.328E-38	335	0.329	0.379	3ht5A.pdb.gz	The 1.9 A structure of the branched-chain amino-acid transaminase (IlvE) from Mycobacterium tuberculosis.
15	PDB:1i1lA	0.668	0.835	2.054E-22	304	0.212	0.270	1i1lA.pdb.gz	Structures of Escherichia coli branched-chain amino acid aminotransferase and its complexes with 4-methylvalerate and 2-methylleucine: induced fit and substrate recognition of the enzyme.
16	PDB:1a0gB	0.587	0.784	1.320E-16	282	0.155	0.213	1a0gB.pdb.gz	Crystal structures of L201A mutant of D-amino acid aminotransferase at 2.0 A resolution: implication of the structural role of Leu201 in transamination.
17	PDB:6q1qB	0.572	0.750	2.005E-16	286	0.150	0.203	6q1qB.pdb.gz
18	PDB:1i2kA	0.563	0.777	1.223E-12	269	0.119	0.171	1i2kA.pdb.gz	Structure and Mechanism of Escherichia coli Aminodeoxychorismate Lyase
19	PDB:4k6nA	0.413	0.448	1.975E-5	352	0.080	0.088	4k6nA.pdb.gz	Structure and catalytic mechanism of yeast 4-amino-4-deoxychorismate lyase
20	PDB:2owlA	0.109	0.125	7.934E-2	302	0.093	0.119	2owlA.pdb.gz	Ring Structure of the Escherichia coli DNA-binding Protein RdgC Associated with Recombination and Replication Fork Repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24288	0.0	696	386	0.850	0.850	BCAT1_MOUSE Branched-chain-amino-acid aminotransferase, cytosolic OS=Mus musculus OX=10090 GN=Bcat1 PE=1 SV=2
2	P54687	0.0	801	386	1.000	1.000	BCAT1_HUMAN Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3
3	P54690	0.0	629	411	0.764	0.718	BCAT1_RAT Branched-chain-amino-acid aminotransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Bcat1 PE=1 SV=1
4	O35854	2.11e-165	470	393	0.578	0.567	BCAT2_RAT Branched-chain-amino-acid aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bcat2 PE=1 SV=1
5	O35855	2.64e-162	462	393	0.567	0.557	BCAT2_MOUSE Branched-chain-amino-acid aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Bcat2 PE=1 SV=2
6	O15382	2.95e-161	459	392	0.557	0.548	BCAT2_HUMAN Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=2
7	M0QXF9	3.36e-158	454	445	0.552	0.479	M0QXF9_HUMAN Branched-chain-amino-acid aminotransferase (Fragment) OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=1
8	M0QZ10	3.88e-158	452	405	0.552	0.526	M0QZ10_HUMAN Branched-chain-amino-acid aminotransferase OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=1
9	Q9VYD5	1.25e-141	412	443	0.497	0.433	Q9VYD5_DROME Branched-chain-amino-acid aminotransferase OS=Drosophila melanogaster OX=7227 GN=Bcat PE=1 SV=2
10	P54688	2.14e-135	395	415	0.497	0.463	BCAT_CAEEL Branched-chain-amino-acid aminotransferase, cytosolic OS=Caenorhabditis elegans OX=6239 GN=bcat-1 PE=2 SV=2
11	P47176	2.62e-111	332	376	0.456	0.468	BCA2_YEAST Branched-chain-amino-acid aminotransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT2 PE=1 SV=1
12	Q6FK92	1.12e-110	330	371	0.448	0.466	Q6FK92_CANGA Branched-chain-amino-acid aminotransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=BAT2 PE=3 SV=1
13	P38891	7.95e-107	321	393	0.433	0.425	BCA1_YEAST Branched-chain-amino-acid aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT1 PE=1 SV=1
14	Q586R0	2.03e-105	317	367	0.430	0.452	Q586R0_TRYB2 Branched-chain amino acid aminotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.285 PE=3 SV=1
15	O14370	4.71e-105	318	427	0.440	0.398	BCA1_SCHPO Branched-chain-amino-acid aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eca39 PE=1 SV=3
16	Q586R1	6.34e-104	313	367	0.425	0.447	Q586R1_TRYB2 Branched-chain amino acid aminotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.275 PE=3 SV=1
17	P9WQ75	1.26e-75	240	368	0.342	0.359	ILVE_MYCTU Branched-chain-amino-acid aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ilvE PE=1 SV=1
18	A0R066	1.01e-69	225	368	0.345	0.361	ILVE_MYCS2 Branched-chain-amino-acid aminotransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ilvE PE=1 SV=1
19	Q9M401	1.22e-52	182	413	0.308	0.288	BCAT3_ARATH Branched-chain-amino-acid aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BCAT3 PE=1 SV=1
20	Q9LPM9	6.50e-48	168	356	0.301	0.326	BCAT6_ARATH Branched-chain-amino-acid aminotransferase 6 OS=Arabidopsis thaliana OX=3702 GN=BCAT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01063 Aminotran_4	1.2e-26	105.5	Amino-transferase class IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269980	0.967	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
2	9606.ENSP00000318351	0.960	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
3	9606.ENSP00000359151	0.947	Dihydrolipoamide branched chain transacylase E2
4	9606.ENSP00000359976	0.941	Cystathionine gamma-lyase
5	9606.ENSP00000359258	0.934	Glutamate-cysteine ligase modifier subunit
6	9606.ENSP00000205402	0.926	Dihydrolipoyl dehydrogenase, mitochondrial
7	9606.ENSP00000229416	0.916	Glutamate-cysteine ligase catalytic subunit
8	9606.ENSP00000385790	0.907	Serine dehydratase-like
9	9606.ENSP00000257549	0.885	L-serine dehydratase/L-threonine deaminase
10	9606.ENSP00000231420	0.845	Alanine--glyoxylate aminotransferase 2, mitochondrial
11	9606.ENSP00000472474	0.823	L-amino-acid oxidase
12	9606.ENSP00000322991	0.811	Branched-chain-amino-acid aminotransferase, mitochondrial
13	9606.ENSP00000264954	0.784	GrpE protein homolog 1, mitochondrial
14	9606.ENSP00000445175	0.781	Lactate dehydrogenase A
15	9606.ENSP00000325548	0.764	Cytosolic non-specific dipeptidase
16	9606.ENSP00000306817	0.760	Ribokinase
17	9606.ENSP00000324842	0.760	Acetoacetyl-CoA synthetase
18	9606.ENSP00000273920	0.753	Enolase-phosphatase E1
19	9606.ENSP00000216951	0.736	Glutathione synthetase
20	9606.ENSP00000333666	0.736	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004084	1.000	branched-chain-amino-acid transaminase activity
GO:0005515	0.996	protein binding
GO:1901363	0.401	heterocyclic compound binding
GO:0097159	0.393	organic cyclic compound binding
GO:0042802	0.336	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0019752	0.990	carboxylic acid metabolic process
GO:0009081	0.979	branched-chain amino acid metabolic process
GO:1901576	0.889	organic substance biosynthetic process
GO:0044249	0.882	cellular biosynthetic process
GO:1901566	0.869	organonitrogen compound biosynthetic process
GO:0046395	0.646	carboxylic acid catabolic process
GO:0044283	0.639	small molecule biosynthetic process
GO:0046394	0.446	carboxylic acid biosynthetic process
GO:0009063	0.445	amino acid catabolic process
GO:0044770	0.368	cell cycle phase transition
GO:1903047	0.322	mitotic cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043231	0.949	intracellular membrane-bounded organelle
GO:0005739	0.892	mitochondrion
GO:0070013	0.379	intracellular organelle lumen
GO:0005634	0.370	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.42	1.000	branched-chain-amino-acid transaminase.

[back to server]